StarFunc result for job id Q92915

User Input

>input (247 residues)
MAAAIASGLIRQKRQAREQHWDRPSASRRRSSPSKNRGLCNGNLVDIFSKVRIFGLKKRR
LRRQDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVK
TGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQ
AMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKP
VNKSKTT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P70379	0.869	0.869	3.848E-43	247	0.984	0.984	P70379.pdb.gz	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1
2	AFDB:P61150	0.634	0.644	1.617E-34	243	0.713	0.724	P61150.pdb.gz	FGF12_RAT Fibroblast growth factor 12 OS=Rattus norvegicus OX=10116 GN=Fgf12 PE=1 SV=1
3	AFDB:A6P7H6	0.683	0.688	4.365E-34	245	0.672	0.678	A6P7H6.pdb.gz	FGF13_XENLA Fibroblast growth factor 13 OS=Xenopus laevis OX=8355 GN=fgf13 PE=2 SV=1
4	AFDB:Q92914	0.640	0.701	6.255E-28	225	0.559	0.613	Q92914.pdb.gz	FGF11_HUMAN Fibroblast growth factor 11 OS=Homo sapiens OX=9606 GN=FGF11 PE=1 SV=1
5	PDB:4jq0A	0.565	0.985	1.727E-21	141	0.474	0.830	4jq0A.pdb.gz	Structural analyses of Ca(2+)/CaM interaction with NaV channel C-termini reveal mechanisms of calcium-dependent regulation.
6	AFDB:Q9EST9	0.508	0.590	4.760E-16	212	0.259	0.302	Q9EST9.pdb.gz	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
7	AFDB:P31371	0.517	0.612	5.616E-16	208	0.247	0.293	P31371.pdb.gz	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
8	AFDB:P48807	0.514	0.479	7.002E-16	266	0.267	0.248	P48807.pdb.gz	FGF5_RAT Fibroblast growth factor 5 OS=Rattus norvegicus OX=10116 GN=Fgf5 PE=2 SV=1
9	AFDB:Q38PL0	0.520	0.614	7.819E-16	208	0.247	0.293	Q38PL0.pdb.gz	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
10	AFDB:P12034	0.512	0.473	1.357E-15	268	0.279	0.257	P12034.pdb.gz	FGF5_HUMAN Fibroblast growth factor 5 OS=Homo sapiens OX=9606 GN=FGF5 PE=1 SV=4
11	AFDB:Q1XG76	0.505	0.600	1.434E-15	207	0.219	0.261	Q1XG76.pdb.gz	Q1XG76_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=si:dkeyp-74c5.3 PE=2 SV=1
12	PDB:3f1rA	0.516	0.805	7.883E-15	157	0.227	0.357	3f1rA.pdb.gz	Homodimerization controls the fibroblast growth factor 9 subfamily's receptor binding and heparan sulfate-dependent diffusion in the extracellular matrix
13	PDB:1ry7A	0.482	0.775	4.802E-11	151	0.190	0.311	1ry7A.pdb.gz
14	PDB:6b0tA	0.429	0.227	8.941E-6	487	0.093	0.047	6b0tA.pdb.gz	Structural Insights into the Induced-fit Inhibition of Fascin by a Small-Molecule Inhibitor.
15	PDB:4qd2B	0.418	0.671	6.513E-5	143	0.089	0.154	4qd2B.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
16	PDB:7t3qA	0.376	0.051	3.407E-4	2103	0.113	0.013	7t3qA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
17	PDB:7t3pA	0.397	0.057	3.804E-4	2066	0.109	0.013	7t3pA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
18	PDB:1t9fA	0.391	0.528	4.744E-4	178	0.061	0.084	1t9fA.pdb.gz
19	PDB:3malA	0.388	0.516	5.013E-4	181	0.093	0.127	3malA.pdb.gz
20	PDB:7t3rA	0.365	0.050	7.793E-4	2130	0.109	0.013	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P70379	0.0	504	247	0.984	0.984	FGF14_MOUSE Fibroblast growth factor 14 OS=Mus musculus OX=10090 GN=Fgf14 PE=2 SV=1
2	Q8R5L7	0.0	508	247	0.988	0.988	FGF14_RAT Fibroblast growth factor 14 OS=Rattus norvegicus OX=10116 GN=Fgf14 PE=2 SV=1
3	Q92915	0.0	515	247	1.000	1.000	FGF14_HUMAN Fibroblast growth factor 14 OS=Homo sapiens OX=9606 GN=FGF14 PE=1 SV=1
4	P61150	5.80e-127	361	243	0.713	0.724	FGF12_RAT Fibroblast growth factor 12 OS=Rattus norvegicus OX=10116 GN=Fgf12 PE=1 SV=1
5	P61328	5.80e-127	361	243	0.713	0.724	FGF12_HUMAN Fibroblast growth factor 12 OS=Homo sapiens OX=9606 GN=FGF12 PE=1 SV=1
6	P61329	5.80e-127	361	243	0.713	0.724	FGF12_MOUSE Fibroblast growth factor 12 OS=Mus musculus OX=10090 GN=Fgf12 PE=1 SV=1
7	A6P7H6	5.87e-118	338	245	0.672	0.678	FGF13_XENLA Fibroblast growth factor 13 OS=Xenopus laevis OX=8355 GN=fgf13 PE=2 SV=1
8	A8K1P5	9.82e-118	338	245	0.676	0.682	A8K1P5_HUMAN Fibroblast growth factor OS=Homo sapiens OX=9606 GN=FGF13 PE=2 SV=1
9	Q92913	9.82e-118	338	245	0.676	0.682	FGF13_HUMAN Fibroblast growth factor 13 OS=Homo sapiens OX=9606 GN=FGF13 PE=1 SV=1
10	P70377	1.01e-116	335	245	0.672	0.678	FGF13_MOUSE Fibroblast growth factor 13 OS=Mus musculus OX=10090 GN=Fgf13 PE=1 SV=2
11	Q9ERW3	1.01e-116	335	245	0.672	0.678	FGF13_RAT Fibroblast growth factor 13 OS=Rattus norvegicus OX=10116 GN=Fgf13 PE=1 SV=2
12	Q92914	1.27e-95	281	225	0.555	0.609	FGF11_HUMAN Fibroblast growth factor 11 OS=Homo sapiens OX=9606 GN=FGF11 PE=1 SV=1
13	Q9EST9	1.79e-36	130	212	0.247	0.288	FGF20_RAT Fibroblast growth factor 20 OS=Rattus norvegicus OX=10116 GN=Fgf20 PE=2 SV=1
14	Q9NP95	7.03e-36	128	211	0.247	0.289	FGF20_HUMAN Fibroblast growth factor 20 OS=Homo sapiens OX=9606 GN=FGF20 PE=1 SV=1
15	Q38PL0	8.21e-36	128	208	0.239	0.284	Q38PL0_DANRE Fibroblast growth factor OS=Danio rerio OX=7955 GN=dob PE=2 SV=1
16	Q2HXK8	1.20e-35	127	203	0.267	0.325	FGF16_DANRE Fibroblast growth factor 16 OS=Danio rerio OX=7955 GN=fgf16 PE=2 SV=1
17	P36364	1.51e-35	127	208	0.235	0.279	FGF9_RAT Fibroblast growth factor 9 OS=Rattus norvegicus OX=10116 GN=Fgf9 PE=2 SV=2
18	P54130	1.51e-35	127	208	0.235	0.279	FGF9_MOUSE Fibroblast growth factor 9 OS=Mus musculus OX=10090 GN=Fgf9 PE=2 SV=2
19	P31371	1.85e-35	127	208	0.235	0.279	FGF9_HUMAN Fibroblast growth factor 9 OS=Homo sapiens OX=9606 GN=FGF9 PE=1 SV=3
20	Q9ESL9	2.24e-35	127	211	0.243	0.284	FGF20_MOUSE Fibroblast growth factor 20 OS=Mus musculus OX=10090 GN=Fgf20 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06268 Fascin	23	16.6	Fascin domain
2	PF00167 FGF	1.1e-37	140.2	Fibroblast growth factor

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010352751.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010372305.1	0.799	Sodium channel protein type 8 subunit alpha isoform X1
2	61622.XP_010383576.1	0.736	Fibroblast growth factor receptor 1
3	61622.XP_010387372.1	0.724	EGF stimulates the growth of various epidermal and epithelial tissues in vivo and in vitro and of some fibroblasts in cell culture. Magnesiotropic hormone that stimulates magnesium reabsorption in the renal distal convoluted tubule via engagement of EGFR and activation of the magnesium channel TRPM6
4	61622.XP_010378799.1	0.683	Fibroblast growth factor receptor 2 isoform X1
5	61622.XP_010386218.1	0.681	Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
6	61622.XP_010365395.1	0.673	Klotho
7	61622.XP_010355571.1	0.637	Insulin-like growth factor I isoform X1
8	61622.XP_010363608.1	0.621	Sodium channel protein type 2 subunit alpha
9	61622.XP_010361178.1	0.617	Kinase insert domain receptor
10	61622.XP_010384710.1	0.616	Fibroblast growth factor receptor 4
11	61622.XP_010382646.1	0.597	Fibroblast growth factor receptor 3 isoform X1
12	61622.XP_010382080.1	0.590	Tau-tubulin kinase 2
13	61622.XP_010370358.1	0.586	Bone morphogenetic protein 4
14	61622.XP_010380355.1	0.574	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
15	61622.XP_010370484.1	0.556	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 mRNAs, 6100 ESTs, 18 Proteins, and 96% coverage of the annotated genomic feature by RNAseq alignments
16	61622.XP_010356428.1	0.555	Fibroblast growth factor-binding protein 2
17	61622.XP_010386077.1	0.552	Bone morphogenetic protein 2
18	61622.XP_010360648.1	0.548	Fms related tyrosine kinase 1
19	61622.XP_010372596.1	0.544	Catenin beta-1
20	61622.XP_010354433.1	0.541	Belongs to the heparin-binding growth factors family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008083	0.999	growth factor activity
GO:0097367	0.342	carbohydrate derivative binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.990	regulation of biological process
GO:0007154	0.986	cell communication
GO:0050794	0.984	regulation of cellular process
GO:0043269	0.959	regulation of monoatomic ion transport
GO:0023052	0.956	signaling
GO:0042391	0.953	regulation of membrane potential
GO:0050896	0.950	response to stimulus
GO:0010959	0.948	regulation of metal ion transport
GO:0032501	0.921	multicellular organismal process
GO:1904062	0.900	regulation of monoatomic cation transmembrane transport
GO:0032412	0.863	regulation of monoatomic ion transmembrane transporter activity
GO:0051716	0.821	cellular response to stimulus
GO:0031098	0.808	stress-activated protein kinase signaling cascade
GO:0048518	0.788	positive regulation of biological process
GO:0007267	0.784	cell-cell signaling
GO:0002028	0.779	regulation of sodium ion transport
GO:0048522	0.754	positive regulation of cellular process
GO:0051924	0.645	regulation of calcium ion transport
GO:1903169	0.644	regulation of calcium ion transmembrane transport
GO:0000165	0.626	MAPK cascade
GO:0048856	0.613	anatomical structure development
GO:0007275	0.587	multicellular organism development
GO:0007254	0.539	JNK cascade
GO:0048731	0.529	system development
GO:0043270	0.415	positive regulation of monoatomic ion transport
GO:2001257	0.394	regulation of cation channel activity
GO:0007399	0.345	nervous system development
GO:0008344	0.331	adult locomotory behavior
GO:0010765	0.331	positive regulation of sodium ion transport
GO:0050905	0.313	neuromuscular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.993	cytoplasm
GO:0005634	0.988	nucleus
GO:0005829	0.916	cytosol
GO:0005576	0.776	extracellular region
GO:0005615	0.542	extracellular space
GO:0032991	0.535	protein-containing complex
GO:0071944	0.520	cell periphery
GO:0005886	0.493	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]