StarFunc result for job id Q92922

User Input

>input (1105 residues)
MAAAAGGGGPGTAVGATGSGIAAAAAGLAVYRRKDGGPATKFWESPETVSQLDSVRVWLG
KHYKKYVHADAPTNKTLAGLVVQLLQFQEDAFGKHVTNPAFTKLPAKCFMDFKAGGALCH
ILGAAYKYKNEQGWRRFDLQNPSRMDRNVEMFMNIEKTLVQNNCLTRPNIYLIPDIDLKL
ANKLKDIIKRHQGTFTDEKSKASHHIYPYSSSQDDEEWLRPVMRKEKQVLVHWGFYPDSY
DTWVHSNDVDAEIEDPPIPEKPWKVHVKWILDTDIFNEWMNEEDYEVDENRKPVSFRQRI
STKNEEPVRSPERRDRKASANARKRKHSPSPPPPTPTESRKKSGKKGQASLYGKRRSQKE
EDEQEDLTKDMEDPTPVPNIEEVVLPKNVNLKKDSENTPVKGGTVADLDEQDEETVTAGG
KEDEDPAKGDQSRSVDLGEDNVTEQTNHIIIPSYASWFDYNCIHVIERRALPEFFNGKNK
SKTPEIYLAYRNFMIDTYRLNPQEYLTSTACRRNLTGDVCAVMRVHAFLEQWGLVNYQVD
PESRPMAMGPPPTPHFNVLADTPSGLVPLHLRSPQVPAAQQMLNFPEKNKEKPVDLQNFG
LRTDIYSKKTLAKSKGASAGREWTEQETLLLLEALEMYKDDWNKVSEHVGSRTQDECILH
FLRLPIEDPYLENSDASLGPLAYQPVPFSQSGNPVMSTVAFLASVVDPRVASAAAKAALE
EFSRVREEVPLELVEAHVKKVQEAARASGKVDPTYGLESSCIAGTGPDEPEKLEGAEEEK
MEADPDGQQPEKAENKVENETDEGDKAQDGENEKNSEKEQDSEVSEDTKSEEKETEENKE
LTDTCKERESDTGKKKVEHEISEGNVATAAAAALASAATKAKHLAAVEERKIKSLVALLV
ETQMKKLEIKLRHFEELETIMDREKEALEQQRQQLLTERQNFHMEQLKYAELRARQQMEQ
QQHGQNPQQAHQHSGGPGLAPLGAAGHPGMMPHQQPPPYPLMHHQMPPPHPPQPGQIPGP
GSMMPGQHMPGRMIPTVAANIHPSGSGPTPPGMPPMPGNILGPRVPLTAPNGMYPPPPQQ
QPPPPPPADGVPPPPAPGPPASAAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q9K1	0.392	0.398	0.000	1089	0.710	0.720	F1Q9K1.pdb.gz	F1Q9K1_DANRE SWI/SNF complex subunit SMARCC1 isoform X1 OS=Danio rerio OX=7955 GN=smarcc1a PE=1 SV=1
2	AFDB:Q92922	0.999	0.999	0.000	1105	1.000	1.000	Q92922.pdb.gz	SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3
3	AFDB:F8VXC8	0.344	0.308	2.620E-100	1245	0.625	0.555	F8VXC8.pdb.gz	F8VXC8_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
4	AFDB:A0A024RB22	0.260	0.237	4.663E-97	1214	0.621	0.565	A0A024RB22.pdb.gz
5	PDB:6lthO	0.260	0.798	4.260E-32	325	0.265	0.902	6lthO.pdb.gz	Structure of nucleosome-bound human BAF complex.
6	PDB:6lthN	0.084	0.355	9.586E-22	261	0.214	0.908	6lthN.pdb.gz	Structure of nucleosome-bound human BAF complex.
7	AFDB:O14470	0.108	0.227	1.072E-20	503	0.152	0.334	O14470.pdb.gz	SSR2_SCHPO SWI/SNF and RSC complexes subunit ssr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssr2 PE=1 SV=3
8	PDB:7vdvW	0.089	0.392	1.973E-20	248	0.204	0.907	7vdvW.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
9	PDB:7vdvX	0.146	0.511	2.973E-20	252	0.209	0.917	7vdvX.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
10	AFDB:O13788	0.107	0.217	7.552E-19	527	0.152	0.319	O13788.pdb.gz	SSR1_SCHPO SWI/SNF and RSC complexes subunit ssr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssr1 PE=1 SV=1
11	PDB:7c4jB	0.147	0.363	1.621E-18	395	0.104	0.291	7c4jB.pdb.gz
12	AFDB:P43609	0.165	0.312	4.542E-18	557	0.129	0.255	P43609.pdb.gz	RSC8_YEAST Chromatin structure-remodeling complex protein RSC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RSC8 PE=1 SV=1
13	PDB:6k15H	0.089	0.245	2.604E-15	393	0.105	0.295	6k15H.pdb.gz	Structure of the RSC complex bound to the nucleosome.
14	AFDB:Q84JG2	0.102	0.218	4.152E-15	469	0.112	0.264	Q84JG2.pdb.gz	SWI3B_ARATH SWI/SNF complex subunit SWI3B OS=Arabidopsis thaliana OX=3702 GN=SWI3B PE=1 SV=1
15	PDB:6k15D	0.115	0.394	8.042E-15	305	0.103	0.374	6k15D.pdb.gz	Structure of the RSC complex bound to the nucleosome.
16	PDB:7egmE	0.089	0.230	8.501E-14	422	0.127	0.332	7egmE.pdb.gz
17	PDB:6tdaL	0.090	0.161	1.662E-12	596	0.100	0.186	6tdaL.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
18	AFDB:Q5RGA4	0.080	0.107	3.184E-5	822	0.062	0.084	Q5RGA4.pdb.gz	MYSM1_DANRE Histone H2A deubiquitinase MYSM1 OS=Danio rerio OX=7955 GN=mysm1 PE=2 SV=2
19	AFDB:Q9VJZ3	0.055	0.078	5.361E-3	695	0.075	0.119	Q9VJZ3.pdb.gz	Q9VJZ3_DROME B double prime 1, isoform A OS=Drosophila melanogaster OX=7227 GN=Bdp1 PE=2 SV=2
20	PDB:2cjjA	0.047	0.653	6.245E-2	63	0.019	0.333	2cjjA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4JDA0	0.0	779	1145	0.424	0.410	A0A0B4JDA0_DROME Moira, isoform B OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=1
2	A0A0G2K9D6	0.0	1859	1083	0.910	0.929	A0A0G2K9D6_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
3	A0A8I5ZP90	0.0	1786	1045	0.881	0.931	A0A8I5ZP90_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
4	A0A8I6A5E1	0.0	1241	1247	0.592	0.524	A0A8I6A5E1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=1
5	A0A8I6AGR8	0.0	1251	1216	0.590	0.536	A0A8I6AGR8_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=1
6	A0A8I6AMA8	0.0	1862	1102	0.911	0.914	A0A8I6AMA8_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=4 SV=1
7	D3ZJU5	0.0	1859	1078	0.910	0.933	D3ZJU5_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcc1 PE=1 SV=1
8	D4A510	0.0	1240	1108	0.592	0.590	D4A510_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily c, member 2 OS=Rattus norvegicus OX=10116 GN=Smarcc2 PE=1 SV=4
9	F1Q9K1	0.0	1346	1089	0.680	0.690	F1Q9K1_DANRE SWI/SNF complex subunit SMARCC1 isoform X1 OS=Danio rerio OX=7955 GN=smarcc1a PE=1 SV=1
10	F8VXC8	0.0	1249	1245	0.607	0.539	F8VXC8_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
11	P97496	0.0	1851	1104	0.910	0.910	SMRC1_MOUSE SWI/SNF complex subunit SMARCC1 OS=Mus musculus OX=10090 GN=Smarcc1 PE=1 SV=2
12	Q6PDG5	0.0	1258	1213	0.595	0.542	SMRC2_MOUSE SWI/SNF complex subunit SMARCC2 OS=Mus musculus OX=10090 GN=Smarcc2 PE=1 SV=2
13	Q7KPY3	0.0	734	1189	0.412	0.383	Q7KPY3_DROME Moira OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=1
14	Q8MSY3	0.0	625	1002	0.365	0.402	Q8MSY3_DROME LD06146p OS=Drosophila melanogaster OX=7227 GN=mor PE=2 SV=1
15	Q8TAQ2	0.0	1260	1214	0.605	0.551	SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1
16	Q92922	0.0	2288	1105	1.000	1.000	SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3
17	Q9VF03	0.0	769	1209	0.428	0.391	Q9VF03_DROME Brahma associated protein 155 kDa OS=Drosophila melanogaster OX=7227 GN=mor PE=1 SV=3
18	G5EF87	2.30e-126	407	789	0.201	0.281	G5EF87_CAEEL SWI/SNF complex subunit SMARCC2 OS=Caenorhabditis elegans OX=6239 GN=swsn-1 PE=1 SV=1
19	H8ESF3	2.70e-126	407	792	0.203	0.283	H8ESF3_CAEEL SWI/SNF complex subunit SMARCC2 OS=Caenorhabditis elegans OX=6239 GN=swsn-1 PE=1 SV=1
20	H8ESF4	2.01e-105	348	685	0.170	0.274	H8ESF4_CAEEL SANT domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=swsn-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16589 BRCT_2	49	15.7	BRCT domain, a BRCA1 C-terminus domain
2	PF06034 DUF919	1.6e+02	13.5	Nucleopolyhedrovirus protein of unknown function (DUF919)
3	PF00249 Myb_DNA-binding	4.4e-09	47.7	Myb-like DNA-binding domain
4	PF13921 Myb_DNA-bind_6	0.00048	31.6	Myb-like DNA-binding domain
5	PF10940 SpeFL	6.2e+02	11.6	Leader peptide SpeFL
6	PF04433 SWIRM	3.8e-27	105.8	SWIRM domain
7	PF16495 SWIRM-assoc_1	1.1e-25	100.7	SWIRM-associated region 1
8	PF16496 SWIRM-assoc_2	1.3e-189	642.1	SWIRM-associated domain at the N-terminal
9	PF16498 SWIRM-assoc_3	1.4e-27	107.0	SWIRM-associated domain at the C-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254480

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263121	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
2	9606.ENSP00000265773	0.999	Probable global transcription activator SNF2L2
3	9606.ENSP00000320485	0.999	AT-rich interactive domain-containing protein 1A
4	9606.ENSP00000323967	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1
5	9606.ENSP00000378414	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
6	9606.ENSP00000392617	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
7	9606.ENSP00000395654	0.999	Transcription activator BRG1
8	9606.ENSP00000397552	0.999	Actin-like protein 6A
9	9606.ENSP00000262188	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	9606.ENSP00000344546	0.998	AT-rich interactive domain-containing protein 1B
11	9606.ENSP00000378307	0.997	Protein polybromo-1
12	9606.ENSP00000414516	0.995	Protein SSXT
13	9606.ENSP00000341805	0.994	PHD finger protein 10
14	9606.ENSP00000436901	0.992	Zinc finger protein ubi-d4
15	9606.ENSP00000267064	0.990	SWI/SNF complex subunit SMARCC2
16	9606.ENSP00000342434	0.988	Tyrosine-protein kinase BAZ1B
17	9606.ENSP00000479526	0.988	Zinc finger protein DPF3
18	9606.ENSP00000335044	0.987	AT-rich interactive domain-containing protein 2
19	9606.ENSP00000216297	0.980	FACT complex subunit SPT16
20	9606.ENSP00000231509	0.980	Glucocorticoid receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003677	0.992	DNA binding
GO:0031492	0.975	nucleosomal DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0001655	0.990	urogenital system development
GO:0050789	0.962	regulation of biological process
GO:0060255	0.935	regulation of macromolecule metabolic process
GO:0080090	0.930	regulation of primary metabolic process
GO:0031323	0.930	regulation of cellular metabolic process
GO:0051171	0.929	regulation of nitrogen compound metabolic process
GO:0030850	0.928	prostate gland development
GO:0009987	0.926	cellular process
GO:0019219	0.918	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.917	regulation of gene expression
GO:0006355	0.888	regulation of DNA-templated transcription
GO:0048518	0.806	positive regulation of biological process
GO:0048522	0.759	positive regulation of cellular process
GO:0010604	0.745	positive regulation of macromolecule metabolic process
GO:0051173	0.733	positive regulation of nitrogen compound metabolic process
GO:0031325	0.721	positive regulation of cellular metabolic process
GO:0071840	0.706	cellular component organization or biogenesis
GO:0045935	0.688	positive regulation of nucleobase-containing compound metabolic process
GO:0016043	0.669	cellular component organization
GO:0045893	0.630	positive regulation of DNA-templated transcription
GO:0006338	0.569	chromatin remodeling
GO:0048519	0.500	negative regulation of biological process
GO:0048523	0.447	negative regulation of cellular process
GO:0009892	0.364	negative regulation of metabolic process
GO:0006357	0.351	regulation of transcription by RNA polymerase II
GO:0010605	0.340	negative regulation of macromolecule metabolic process
GO:0071704	0.324	organic substance metabolic process
GO:0031324	0.315	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1902494	1.000	catalytic complex
GO:0000785	1.000	chromatin
GO:0140513	1.000	nuclear protein-containing complex
GO:0005654	0.999	nucleoplasm
GO:0070603	0.989	SWI/SNF superfamily-type complex
GO:0016514	0.981	SWI/SNF complex
GO:0005737	0.972	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]