StarFunc result for job id Q92925

User Input

>input (531 residues)
MSGRGAGGFPLPPLSPGGGAVAAALGAPPPPAGPGMLPGPALRGPGPAGGVGGPGAAAFR
PMGPAGPAAQYQRPGMSPGNRMPMAGLQVGPPAGSPFGAAAPLRPGMPPTMMDPFRKRLL
VPQAQPPMPAQRRGLKRRKMADKVLPQRIRELVPESQAYMDLLAFERKLDQTIARKRMEI
QEAIKKPLTQKRKLRIYISNTFSPSKAEGDSAGTAGTPGGTPAGDKVASWELRVEGKLLD
DPSKQKRKFSSFFKSLVIELDKELYGPDNHLVEWHRMPTTQETDGFQVKRPGDLNVKCTL
LLMLDHQPPQYKLDPRLARLLGVHTQTRAAIMQALWLYIKHNQLQDGHEREYINCNRYFR
QIFSCGRLRFSEIPMKLAGLLQHPDPIVINHVISVDPNDQKKTACYDIDVEVDDPLKAQM
SNFLASTTNQQEIASLDVKIHETIESINQLKTQRDFMLSFSTDPQDFIQEWLRSQRRDLK
IITDVIGNPEEERRAAFYHQPWAQEAVGRHIFAKVQQRRQELEQVLGIRLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92925	1.000	1.000	6.303E-94	531	1.000	1.000	Q92925.pdb.gz	SMRD2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3
2	AFDB:B2KL77	0.685	0.762	2.429E-67	476	0.620	0.691	B2KL77.pdb.gz	B2KL77_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Danio rerio OX=7955 GN=smarcd3b PE=1 SV=1
3	AFDB:A0A1L1QZS5	0.606	0.764	2.030E-59	413	0.537	0.690	A0A1L1QZS5.pdb.gz
4	AFDB:Q09646	0.707	0.838	7.878E-54	446	0.420	0.500	Q09646.pdb.gz	SWIC1_CAEEL SWI/SNF chromatin-remodeling accessory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ham-3 PE=1 SV=1
5	AFDB:O02101	0.701	0.826	2.565E-53	449	0.426	0.503	O02101.pdb.gz	SWIC2_CAEEL SWI/SNF chromatin-remodeling accessory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=swsn-2.2 PE=1 SV=2
6	PDB:7vdvY	0.357	0.748	5.392E-22	245	0.335	0.727	7vdvY.pdb.gz	Structure of human chromatin-remodelling PBAF complex bound to a nucleosome.
7	PDB:7egmH	0.402	0.523	1.231E-19	388	0.168	0.229	7egmH.pdb.gz
8	PDB:6v8oM	0.220	0.344	2.349E-8	310	0.085	0.145	6v8oM.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
9	PDB:6k15I	0.213	0.413	2.641E-6	244	0.056	0.123	6k15I.pdb.gz	Structure of the RSC complex bound to the nucleosome.
10	PDB:6uxvH	0.277	0.516	1.552E-5	257	0.066	0.136	6uxvH.pdb.gz	Cryo-EM structure of SWI/SNF complex bound to a nucleosome.
11	PDB:5svan	0.166	0.364	1.965E-4	200	0.045	0.120	5svan.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
12	PDB:6tdaO	0.189	0.417	2.970E-4	212	0.051	0.127	6tdaO.pdb.gz	Structure of SWI/SNF chromatin remodeller RSC bound to a nucleosome.
13	PDB:5nzuD	0.083	0.097	5.050E-2	427	0.038	0.047	5nzuD.pdb.gz
14	PDB:7kzpQ	0.110	0.083	5.683E-2	754	0.124	0.088	7kzpQ.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
15	PDB:6xt9A	0.101	0.096	6.784E-2	567	0.040	0.037	6xt9A.pdb.gz
16	AFDB:K9ZTJ6	0.074	0.074	8.716E-2	535	0.149	0.148	K9ZTJ6.pdb.gz	K9ZTJ6_XENLA Nucleoporin 54kDa S homeolog isoform X2 OS=Xenopus laevis OX=8355 GN=nup54.S PE=1 SV=1
17	AFDB:P34402	0.084	0.060	1.242E-1	808	0.153	0.100	P34402.pdb.gz	SAS4_CAEEL Spindle assembly abnormal protein 4 OS=Caenorhabditis elegans OX=6239 GN=sas-4 PE=1 SV=2
18	AFDB:Q9EQZ7	0.092	0.038	3.011E-1	1530	0.053	0.018	Q9EQZ7.pdb.gz	RIMS2_MOUSE Regulating synaptic membrane exocytosis protein 2 OS=Mus musculus OX=10090 GN=Rims2 PE=1 SV=1
19	AFDB:F4IAG1	0.090	0.051	4.291E-1	1094	0.085	0.041	F4IAG1.pdb.gz	F4IAG1_ARATH Starch synthase 3 OS=Arabidopsis thaliana OX=3702 GN=SS3 PE=1 SV=1
20	AFDB:Q96G42	0.084	0.078	4.552E-1	594	0.121	0.108	Q96G42.pdb.gz	KLD7B_HUMAN Kelch domain-containing protein 7B OS=Homo sapiens OX=9606 GN=KLHDC7B PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A090N8Z9	0.0	676	470	0.633	0.715	A0A090N8Z9_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Homo sapiens OX=9606 GN=SMARCD3 PE=3 SV=1
2	A0A8I5ZQQ2	0.0	677	483	0.629	0.692	A0A8I5ZQQ2_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
3	A0A8I6A286	0.0	675	461	0.629	0.725	A0A8I6A286_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
4	A0A8I6AJE1	0.0	577	474	0.565	0.633	A0A8I6AJE1_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=1
5	B2KL77	0.0	659	476	0.618	0.689	B2KL77_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Danio rerio OX=7955 GN=smarcd3b PE=1 SV=1
6	B9EGA3	0.0	999	494	0.930	1.000	B9EGA3_HUMAN SMARCD2 protein OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=1
7	D3ZBS9	0.0	615	520	0.588	0.600	D3ZBS9_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 OS=Rattus norvegicus OX=10116 GN=Smarcd1 PE=3 SV=2
8	E7EYW7	0.0	754	501	0.714	0.756	E7EYW7_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 isoform X1 OS=Danio rerio OX=7955 GN=smarcd2 PE=3 SV=1
9	J3KMX2	0.0	941	456	0.859	1.000	J3KMX2_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=1
10	Q5U3Y2	0.0	679	470	0.635	0.717	Q5U3Y2_RAT SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 3 OS=Rattus norvegicus OX=10116 GN=Smarcd3 PE=3 SV=1
11	Q61466	0.0	641	515	0.614	0.633	SMRD1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Mus musculus OX=10090 GN=Smarcd1 PE=1 SV=3
12	Q6P9Z1	0.0	676	483	0.627	0.689	SMRD3_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Mus musculus OX=10090 GN=Smarcd3 PE=1 SV=2
13	Q6STE5	0.0	676	483	0.627	0.689	SMRD3_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3 OS=Homo sapiens OX=9606 GN=SMARCD3 PE=1 SV=1
14	Q802C8	0.0	641	510	0.621	0.647	Q802C8_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Danio rerio OX=7955 GN=wu:fa10h07 PE=1 SV=1
15	Q92925	0.0	1086	531	1.000	1.000	SMRD2_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2 PE=1 SV=3
16	Q96GM5	0.0	641	515	0.614	0.633	SMRD1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=2
17	Q9VYG2	0.0	555	515	0.507	0.522	BAP60_DROME Brahma-associated protein of 60 kDa OS=Drosophila melanogaster OX=7227 GN=Bap60 PE=1 SV=1
18	Q09646	1.82e-146	430	446	0.409	0.487	SWIC1_CAEEL SWI/SNF chromatin-remodeling accessory subunit 1 OS=Caenorhabditis elegans OX=6239 GN=ham-3 PE=1 SV=1
19	O02101	2.07e-137	407	449	0.416	0.492	SWIC2_CAEEL SWI/SNF chromatin-remodeling accessory subunit 2 OS=Caenorhabditis elegans OX=6239 GN=swsn-2.2 PE=1 SV=2
20	F8VZ70	8.53e-88	273	278	0.299	0.572	F8VZ70_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1 (Fragment) OS=Homo sapiens OX=9606 GN=SMARCD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02201 SWIB	1.6e-15	68.0	SWIB/MDM2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010378336.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010386815.1	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 isoform X1
2	61622.XP_010372033.1	0.997	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 4
3	61622.XP_010372176.1	0.997	Belongs to the actin family.
4	61622.XP_010378704.1	0.997	AT-rich interaction domain 1A
5	61622.XP_010373046.1	0.996	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 1
6	61622.XP_010368133.1	0.995	Belongs to the SNF5 family.
7	61622.XP_010383661.1	0.995	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1 isoform X1
8	61622.XP_010363299.1	0.993	Protein polybromo-1 isoform X1
9	61622.XP_010378258.1	0.992	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	61622.XP_010376163.1	0.990	SWI/SNF related, matrix associated, actin dependent regulator of chromatin subfamily c member 2
11	61622.XP_010386649.1	0.990	PHD finger protein 10
12	61622.XP_010379853.1	0.989	AT-rich interactive domain-containing protein 1B
13	61622.XP_010362714.1	0.986	SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily a, member 2
14	61622.XP_010380581.1	0.986	AT-rich interaction domain 2
15	61622.XP_010379053.1	0.981	SS18, nBAF chromatin remodeling complex subunit
16	61622.XP_010354080.1	0.977	Double PHD fingers 3
17	61622.XP_010376030.1	0.964	Belongs to the actin family.
18	61622.XP_010351092.1	0.960	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 3 codons
19	61622.XP_010374675.1	0.960	Bromodomain-containing protein 7 isoform X1
20	61622.XP_010364043.1	0.957	Myb like, SWIRM and MPN domains 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0003677	0.999	DNA binding
GO:0044877	0.995	protein-containing complex binding
GO:0031491	0.990	nucleosome binding
GO:0031490	0.988	chromatin DNA binding
GO:0031492	0.982	nucleosomal DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0016043	0.956	cellular component organization
GO:0006325	0.910	chromatin organization
GO:0006338	0.888	chromatin remodeling
GO:0065007	0.878	biological regulation
GO:0034728	0.867	nucleosome organization
GO:0050789	0.866	regulation of biological process
GO:0050794	0.837	regulation of cellular process
GO:0060255	0.785	regulation of macromolecule metabolic process
GO:0022411	0.754	cellular component disassembly
GO:0032984	0.744	protein-containing complex disassembly
GO:0048518	0.695	positive regulation of biological process
GO:0010468	0.680	regulation of gene expression
GO:0051171	0.613	regulation of nitrogen compound metabolic process
GO:0031323	0.613	regulation of cellular metabolic process
GO:0080090	0.590	regulation of primary metabolic process
GO:0048522	0.559	positive regulation of cellular process
GO:0019219	0.551	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.489	regulation of cellular biosynthetic process
GO:0010556	0.485	regulation of macromolecule biosynthetic process
GO:0010604	0.449	positive regulation of macromolecule metabolic process
GO:0006355	0.448	regulation of DNA-templated transcription
GO:0008152	0.354	metabolic process
GO:0051173	0.340	positive regulation of nitrogen compound metabolic process
GO:0031325	0.337	positive regulation of cellular metabolic process
GO:0045935	0.329	positive regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.995	intracellular non-membrane-bounded organelle
GO:0032991	0.986	protein-containing complex
GO:0005694	0.946	chromosome
GO:0000785	0.937	chromatin
GO:1904949	0.928	ATPase complex
GO:0070603	0.921	SWI/SNF superfamily-type complex
GO:0016514	0.869	SWI/SNF complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]