StarFunc result for job id Q92932

User Input

>input (1015 residues)
MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGR
CQKVPAMDFYRYEVSPVALQRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRP
EASSPARPSKHSVGSERRYSREGGAALANALRRHLPFLEALSQAPASDVLARTHTAQDRP
PAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRH
HLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSS
TGDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELMAGLMQGVDHGVARGSPGRAALGES
GEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARP
LDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGP
SKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVP
SSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKL
KFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYCLRHSSQHRLKEKLSGLGGDPGA
DATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQ
SNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVL
TYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCV
VIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNET
RTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDM
VLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q63475	0.339	0.343	0.000	1004	0.693	0.700	Q63475.pdb.gz	PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2 OS=Rattus norvegicus OX=10116 GN=Ptprn2 PE=1 SV=1
2	AFDB:Q92932	1.000	1.000	0.000	1015	1.000	1.000	Q92932.pdb.gz	PTPR2_HUMAN Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2 PE=1 SV=2
3	PDB:3ps5A	0.246	0.466	2.562E-24	529	0.106	0.204	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
4	PDB:5xzrA	0.259	0.498	3.191E-24	519	0.105	0.206	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
5	AFDB:Q62656	0.263	0.117	4.996E-24	2316	0.209	0.092	Q62656.pdb.gz	PTPRZ_RAT Receptor-type tyrosine-protein phosphatase zeta OS=Rattus norvegicus OX=10116 GN=Ptprz1 PE=1 SV=1
6	PDB:4gwfA	0.260	0.521	5.529E-24	497	0.105	0.215	4gwfA.pdb.gz
7	AFDB:P23471	0.257	0.115	6.224E-24	2315	0.189	0.083	P23471.pdb.gz	PTPRZ_HUMAN Receptor-type tyrosine-protein phosphatase zeta OS=Homo sapiens OX=9606 GN=PTPRZ1 PE=1 SV=4
8	AFDB:F1Q6T9	0.261	0.228	6.947E-24	1168	0.178	0.155	F1Q6T9.pdb.gz	F1Q6T9_DANRE Tyrosine-protein phosphatase non-receptor type OS=Danio rerio OX=7955 GN=ptpn21 PE=3 SV=2
9	PDB:6krwA	0.273	0.870	9.580E-24	306	0.088	0.291	6krwA.pdb.gz
10	AFDB:Q16825	0.263	0.228	2.328E-23	1174	0.180	0.156	Q16825.pdb.gz	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
11	AFDB:Q9VUH6	0.255	0.146	2.157E-17	1833	0.152	0.084	Q9VUH6.pdb.gz	Q9VUH6_DROME Myopic OS=Drosophila melanogaster OX=7227 GN=mop PE=1 SV=2
12	PDB:3m4uA	0.237	0.802	1.242E-16	285	0.076	0.270	3m4uA.pdb.gz
13	AFDB:D4A2D5	0.267	0.335	1.267E-14	804	0.099	0.124	D4A2D5.pdb.gz	D4A2D5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptpn22 PE=1 SV=1
14	AFDB:M9NFQ7	0.082	0.085	5.910E-4	962	0.090	0.095	M9NFQ7.pdb.gz	M9NFQ7_DROME RNA-binding Fox protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=1
15	PDB:3s4oA	0.124	0.637	1.336E-3	163	0.031	0.190	3s4oA.pdb.gz
16	PDB:4ercA	0.112	0.627	4.478E-3	150	0.032	0.213	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
17	PDB:5xjvB	0.109	0.504	6.227E-3	171	0.028	0.164	5xjvB.pdb.gz
18	PDB:7v61B	0.086	0.108	1.079E-2	751	0.024	0.032	7v61B.pdb.gz
19	PDB:2a10C	0.067	0.418	1.204E-2	107	0.018	0.168	2a10C.pdb.gz
20	AFDB:O14867	0.053	0.066	3.266E-2	736	0.080	0.110	O14867.pdb.gz	BACH1_HUMAN Transcription regulator protein BACH1 OS=Homo sapiens OX=9606 GN=BACH1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P80560	0.0	1334	1001	0.678	0.687	PTPR2_MOUSE Receptor-type tyrosine-protein phosphatase N2 OS=Mus musculus OX=10090 GN=Ptprn2 PE=1 SV=2
2	Q16849	0.0	670	979	0.330	0.342	PTPRN_HUMAN Receptor-type tyrosine-protein phosphatase-like N OS=Homo sapiens OX=9606 GN=PTPRN PE=1 SV=1
3	Q60673	0.0	681	979	0.334	0.346	PTPRN_MOUSE Receptor-type tyrosine-protein phosphatase-like N OS=Mus musculus OX=10090 GN=Ptprn PE=1 SV=2
4	Q63259	0.0	678	983	0.333	0.344	PTPRN_RAT Receptor-type tyrosine-protein phosphatase-like N OS=Rattus norvegicus OX=10116 GN=Ptprn PE=1 SV=2
5	Q63475	0.0	1371	1004	0.692	0.699	PTPR2_RAT Receptor-type tyrosine-protein phosphatase N2 OS=Rattus norvegicus OX=10116 GN=Ptprn2 PE=1 SV=1
6	Q92932	0.0	2076	1015	1.000	1.000	PTPR2_HUMAN Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2 PE=1 SV=2
7	Q9Y4I9	0.0	2000	986	0.969	0.998	Q9Y4I9_HUMAN Tyrosine phosphatase IA-2beta OS=Homo sapiens OX=9606 PE=2 SV=1
8	Q8MQR5	3.56e-153	472	686	0.262	0.388	Q8MQR5_DROME GH26549p (Fragment) OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=2 SV=1
9	Q59E11	2.38e-147	474	1306	0.262	0.204	Q59E11_DROME IA-2 protein tyrosine phosphatase, isoform D OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=1 SV=2
10	Q9VPV8	4.93e-147	474	1319	0.262	0.202	Q9VPV8_DROME IA-2 protein tyrosine phosphatase, isoform C OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=1 SV=4
11	Q7YTY8	4.97e-147	473	1287	0.262	0.207	Q7YTY8_DROME GH05223p OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=2 SV=1
12	M9PAZ4	6.73e-147	473	1318	0.262	0.202	M9PAZ4_DROME IA-2 protein tyrosine phosphatase, isoform E OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=1 SV=1
13	Q9BKN7	2.01e-138	424	429	0.206	0.487	Q9BKN7_DROME IA2 (Fragment) OS=Drosophila melanogaster OX=7227 GN=IA-2 PE=2 SV=1
14	G5EGJ5	1.81e-89	305	767	0.172	0.228	IDA1_CAEEL Receptor-type tyrosine-protein phosphatase-like ida-1 OS=Caenorhabditis elegans OX=6239 GN=ida-1 PE=1 SV=1
15	F1NWE3	8.01e-52	201	1516	0.113	0.076	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
16	A5HV10	8.06e-52	197	709	0.110	0.158	A5HV10_RAT Receptor-like protein tyrosine phosphatase kappa (Fragment) OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
17	Q8IRM6	2.64e-51	191	498	0.106	0.217	Q8IRM6_DROME Protein tyrosine phosphatase Meg2, isoform D OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
18	Q13332	2.76e-51	200	1948	0.106	0.055	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
19	A5I9F0	6.13e-51	198	1439	0.110	0.078	A5I9F0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprk PE=2 SV=1
20	Q64604	7.02e-51	198	1898	0.103	0.055	PTPRF_RAT Receptor-type tyrosine-protein phosphatase F OS=Rattus norvegicus OX=10116 GN=Ptprf PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	32	15.8	Dual specificity phosphatase, catalytic domain
2	PF11548 Receptor_IA-2	3.5e-30	115.2	Protein-tyrosine phosphatase receptor IA-2
3	PF14948 RESP18	0.013	27.1	RESP18 domain
4	PF00102 Y_phosphatase	2.6e-71	251.5	Protein-tyrosine phosphatase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374069

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295718	0.885	Receptor-type tyrosine-protein phosphatase-like N
2	9606.ENSP00000386104	0.718	Carboxypeptidase E
3	9606.ENSP00000263373	0.717	Spectrin beta chain, non-erythrocytic 4
4	9606.ENSP00000365437	0.683	Glutamate decarboxylase 2
5	9606.ENSP00000335074	0.642	Appetite-regulating hormone
6	9606.ENSP00000262545	0.627	Neuroendocrine convertase 2
7	9606.ENSP00000300175	0.625	Neuroendocrine protein 7B2
8	9606.ENSP00000369756	0.615	Receptor-type tyrosine-protein phosphatase alpha
9	9606.ENSP00000355893	0.613	Zinc transporter 10
10	9606.ENSP00000314196	0.605	Ghrelin O-acyltransferase
11	9606.ENSP00000368244	0.603	Secretogranin-1
12	9606.ENSP00000415011	0.602	Zinc transporter 8
13	9606.ENSP00000370713	0.577	Double-stranded RNA-specific editase B2
14	9606.ENSP00000269571	0.574	Receptor tyrosine-protein kinase erbB-2
15	9606.ENSP00000327417	0.569	G-protein coupled receptor 39
16	9606.ENSP00000380432	0.561	Insulin
17	9606.ENSP00000364512	0.544	Glucose-6-phosphatase 2
18	9606.ENSP00000265641	0.538	Carnitine O-palmitoyltransferase 1, liver isoform
19	9606.ENSP00000314901	0.537	Leucine rich repeat neuronal 1
20	9606.ENSP00000280362	0.534	6-pyruvoyl tetrahydrobiopterin synthase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0005515	0.994	protein binding
GO:0004888	0.914	transmembrane signaling receptor activity
GO:0005001	0.876	transmembrane receptor protein tyrosine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0044238	0.927	primary metabolic process
GO:0006807	0.905	nitrogen compound metabolic process
GO:1901564	0.899	organonitrogen compound metabolic process
GO:0036211	0.834	protein modification process
GO:0065007	0.823	biological regulation
GO:0044237	0.813	cellular metabolic process
GO:0016311	0.772	dephosphorylation
GO:0050789	0.766	regulation of biological process
GO:0006470	0.764	protein dephosphorylation
GO:0050794	0.717	regulation of cellular process
GO:0050896	0.559	response to stimulus
GO:0023052	0.485	signaling
GO:0007154	0.485	cell communication
GO:0051179	0.438	localization
GO:0006810	0.366	transport
GO:0051716	0.353	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0005737	0.998	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0012505	0.996	endomembrane system
GO:0031982	0.989	vesicle
GO:0071944	0.969	cell periphery
GO:0005886	0.963	plasma membrane
GO:0031090	0.960	organelle membrane
GO:0098588	0.920	bounding membrane of organelle
GO:0031410	0.916	cytoplasmic vesicle
GO:0030659	0.738	cytoplasmic vesicle membrane
GO:0030141	0.684	secretory granule
GO:0032991	0.443	protein-containing complex
GO:0070013	0.401	intracellular organelle lumen
GO:0043235	0.363	receptor complex
GO:0101003	0.323	ficolin-1-rich granule membrane
GO:0005634	0.320	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]