StarFunc result for job id Q92934

User Input

>input (168 residues)
MFQIPEFEPSEQEDSSSAERGLGPSPAGDGPSGSGKHHRQAPGLLWDASHQQEQPTSSSH
HGGAGAVEIRSRHSSYPAGTEDDEGMGEEPSPFRGRSRSAPPNLWAAQRYGRELRRMSDE
FVDSFKKGLPRPKSAGTATQMRQSSSWTRVFQSWWDRNLGRGSSAPSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R562	0.570	0.570	4.639E-22	168	1.000	1.000	A0A024R562.pdb.gz
2	AFDB:Q45KI9	0.381	0.382	1.849E-16	167	0.804	0.808	Q45KI9.pdb.gz	Q45KI9_CANLF BCL2 associated agonist of cell death OS=Canis lupus familiaris OX=9615 GN=BAD PE=2 SV=1
3	AFDB:V9GXY5	0.207	0.191	1.920E-1	187	0.196	0.176	V9GXY5.pdb.gz	V9GXY5_MOUSE Reproductive homeobox 3A (Fragment) OS=Mus musculus OX=10090 GN=Rhox3a PE=4 SV=1
4	AFDB:P38749	0.113	0.078	2.061E-1	330	0.173	0.088	P38749.pdb.gz	YAP3_YEAST AP-1-like transcription factor YAP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YAP3 PE=1 SV=1
5	AFDB:F4ICB6	0.172	0.061	3.153E-1	709	0.149	0.035	F4ICB6.pdb.gz	IBS1_ARATH Protein IMPAIRED IN BABA-INDUCED STERILITY 1 OS=Arabidopsis thaliana OX=3702 GN=IBS1 PE=3 SV=1
6	AFDB:P57102	0.169	0.142	3.900E-1	208	0.143	0.115	P57102.pdb.gz	HAND2_DANRE Heart- and neural crest derivatives-expressed protein 2 OS=Danio rerio OX=7955 GN=hand2 PE=2 SV=1
7	AFDB:Q6UXG3	0.201	0.113	3.900E-1	332	0.179	0.090	Q6UXG3.pdb.gz	CLM9_HUMAN CMRF35-like molecule 9 OS=Homo sapiens OX=9606 GN=CD300LG PE=1 SV=2
8	AFDB:Q39237	0.164	0.078	4.187E-1	368	0.101	0.046	Q39237.pdb.gz	TGA1_ARATH Transcription factor TGA1 OS=Arabidopsis thaliana OX=3702 GN=TGA1 PE=1 SV=2
9	AFDB:Q69Y51	0.122	0.066	4.494E-1	401	0.244	0.102	Q69Y51.pdb.gz	Q69Y51_ORYSJ BHLH transcription factor PTF1 OS=Oryza sativa subsp. japonica OX=39947 GN=P0698A06.26-2 PE=3 SV=1
10	AFDB:Q6IFU8	0.151	0.067	4.824E-1	433	0.167	0.065	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
11	PDB:4h9sA	0.110	0.195	2.796	89	0.089	0.169	4h9sA.pdb.gz
12	PDB:5xtdW	0.157	0.190	5.289	138	0.107	0.130	5xtdW.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
13	PDB:7ak6g	0.166	0.243	5.678	102	0.060	0.098	7ak6g.pdb.gz	Structural basis for a complex I mutation that blocks pathological ROS production.
14	PDB:6t9iF	0.150	0.201	6.542	111	0.083	0.126	6t9iF.pdb.gz
15	PDB:7ajtCL	0.210	0.054	6.542	781	0.077	0.017	7ajtCL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:7d63RJ	0.206	0.053	7.023	796	0.077	0.016	7d63RJ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
17	PDB:5z3gX	0.128	0.109	8.686	202	0.036	0.030	5z3gX.pdb.gz	Cryo-EM structure of an early precursor of large ribosomal subunit reveals a half-assembled intermediate.
18	PDB:1kx5A	0.146	0.177	9.323	135	0.119	0.148	1kx5A.pdb.gz	Solvent Mediated Interactions in the Structure of the Nucleosome Core Particle at 1.9 A Resolution
19	PDB:4v8mBr	0.113	0.058	9.323	367	0.054	0.025	4v8mBr.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:6rlbD	0.146	0.064	9.323	446	0.071	0.027	6rlbD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92934	3.34e-119	335	168	1.000	1.000	BAD_HUMAN Bcl2-associated agonist of cell death OS=Homo sapiens OX=9606 GN=BAD PE=1 SV=3
2	Q45KI9	4.49e-79	234	167	0.804	0.808	Q45KI9_CANLF BCL2 associated agonist of cell death OS=Canis lupus familiaris OX=9615 GN=BAD PE=2 SV=1
3	Q61337	3.78e-74	223	204	0.750	0.618	BAD_MOUSE Bcl2-associated agonist of cell death OS=Mus musculus OX=10090 GN=Bad PE=1 SV=1
4	O35147	2.02e-72	218	205	0.756	0.620	BAD_RAT Bcl2-associated agonist of cell death OS=Rattus norvegicus OX=10116 GN=Bad PE=1 SV=2
5	Q9I9N2	6.09e-18	77.8	146	0.250	0.288	Q9I9N2_DANRE BCL2-antagonist of cell death b isoform 2 OS=Danio rerio OX=7955 GN=bad PE=2 SV=2
6	Q4V925	2.71e-16	73.6	147	0.244	0.279	Q4V925_DANRE BCL2-antagonist of cell death OS=Danio rerio OX=7955 GN=bad PE=1 SV=1
7	Q9TU34	3.3	30.4	2709	0.101	0.006	ITPR1_BOVIN Inositol 1,4,5-trisphosphate receptor type 1 OS=Bos taurus OX=9913 GN=ITPR1 PE=1 SV=1
8	Q9QWN7	3.4	30.4	611	0.077	0.021	Q9QWN7_RAT Cyclic nucleotide-gated channel OS=Rattus norvegicus OX=10116 GN=Cnga3 PE=2 SV=1
9	A0A0G2K054	4.1	30.0	611	0.077	0.021	A0A0G2K054_RAT Cyclic nucleotide gated channel subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Cnga3 PE=4 SV=1
10	A0A0G2JVT7	4.3	30.0	607	0.077	0.021	A0A0G2JVT7_RAT Cyclic nucleotide gated channel subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Cnga3 PE=4 SV=2
11	A0A8I5ZLS2	4.5	30.0	2419	0.137	0.010	A0A8I5ZLS2_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
12	A0A0G2KB10	4.6	30.0	2523	0.137	0.009	A0A0G2KB10_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
13	Q9ER32	4.6	30.0	632	0.077	0.021	Q9ER32_RAT Cyclic nucleotide gated channel subunit alpha 3 OS=Rattus norvegicus OX=10116 GN=Cnga3 PE=4 SV=1
14	D4A5H6	4.7	30.0	2294	0.137	0.010	D4A5H6_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=2
15	A0A8I6AUV5	4.9	30.0	2426	0.137	0.009	A0A8I6AUV5_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
16	A0A8I6A5I9	5.0	30.0	2526	0.137	0.009	A0A8I6A5I9_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
17	A0A8I6A709	5.2	30.0	2520	0.137	0.009	A0A8I6A709_RAT [histone H3]-lysine(36) N-trimethyltransferase OS=Rattus norvegicus OX=10116 GN=Setd2 PE=1 SV=1
18	E9Q5F9	5.2	30.0	2537	0.137	0.009	SETD2_MOUSE Histone-lysine N-methyltransferase SETD2 OS=Mus musculus OX=10090 GN=Setd2 PE=1 SV=1
19	P53552	5.4	30.0	1597	0.119	0.013	THO2_YEAST THO complex subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=THO2 PE=1 SV=1
20	Q9C0C6	8.5	29.3	399	0.179	0.075	CIPC_HUMAN CLOCK-interacting pacemaker OS=Homo sapiens OX=9606 GN=CIPC PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10514 Bcl-2_BAD	4.2e-91	315.3	Pro-apoptotic Bcl-2 protein, BAD
2	PF08945 Bclx_interact	0.72	21.0	Bcl-x interacting, BH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378040

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000302564	0.999	Bcl-2-like protein 1
2	9606.ENSP00000381185	0.995	Apoptosis regulator Bcl-2
3	9606.ENSP00000451828	0.994	RAC-alpha serine/threonine-protein kinase
4	9606.ENSP00000251849	0.990	RAF proto-oncogene serine/threonine-protein kinase
5	9606.ENSP00000379287	0.990	14-3-3 protein zeta/delta
6	9606.ENSP00000371267	0.987	14-3-3 protein theta
7	9606.ENSP00000340989	0.983	14-3-3 protein sigma
8	9606.ENSP00000309591	0.977	cAMP-dependent protein kinase catalytic subunit alpha
9	9606.ENSP00000361930	0.974	14-3-3 protein beta/alpha
10	9606.ENSP00000378974	0.973	Mitogen-activated protein kinase 8
11	9606.ENSP00000264335	0.972	14-3-3 protein epsilon
12	9606.ENSP00000248975	0.969	14-3-3 protein eta
13	9606.ENSP00000338345	0.965	Alpha-synuclein
14	9606.ENSP00000376943	0.964	Bcl-2-like protein 11
15	9606.ENSP00000306330	0.949	14-3-3 protein gamma
16	9606.ENSP00000307786	0.948	Cytochrome c
17	9606.ENSP00000311032	0.948	Caspase-3
18	9606.ENSP00000250405	0.941	Bcl-2-like protein 2
19	9606.ENSP00000358022	0.941	Induced myeloid leukemia cell differentiation protein Mcl-1
20	9606.ENSP00000263025	0.928	Mitogen-activated protein kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019900	1.000	kinase binding
GO:0043028	0.999	cysteine-type endopeptidase regulator activity involved in apoptotic process
GO:0016505	0.998	peptidase activator activity involved in apoptotic process
GO:0019901	0.920	protein kinase binding
GO:0008656	0.859	cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0019902	0.392	phosphatase binding
GO:0003824	0.379	catalytic activity
GO:0140096	0.303	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048522	0.996	positive regulation of cellular process
GO:0010941	0.991	regulation of cell death
GO:0050896	0.987	response to stimulus
GO:0009987	0.987	cellular process
GO:0043067	0.982	regulation of programmed cell death
GO:0051716	0.979	cellular response to stimulus
GO:0019222	0.976	regulation of metabolic process
GO:0007154	0.970	cell communication
GO:0042981	0.970	regulation of apoptotic process
GO:0023052	0.968	signaling
GO:0080090	0.961	regulation of primary metabolic process
GO:0060255	0.961	regulation of macromolecule metabolic process
GO:0007165	0.960	signal transduction
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0010942	0.927	positive regulation of cell death
GO:0043065	0.918	positive regulation of apoptotic process
GO:0031323	0.914	regulation of cellular metabolic process
GO:0006915	0.878	apoptotic process
GO:0065009	0.857	regulation of molecular function
GO:0051246	0.853	regulation of protein metabolic process
GO:0009893	0.848	positive regulation of metabolic process
GO:0071704	0.792	organic substance metabolic process
GO:0044238	0.791	primary metabolic process
GO:0010604	0.782	positive regulation of macromolecule metabolic process
GO:0006807	0.759	nitrogen compound metabolic process
GO:0006950	0.740	response to stress
GO:0043085	0.706	positive regulation of catalytic activity
GO:0035556	0.698	intracellular signal transduction
GO:1901564	0.696	organonitrogen compound metabolic process
GO:0048583	0.694	regulation of response to stimulus
GO:0048519	0.689	negative regulation of biological process
GO:0051247	0.687	positive regulation of protein metabolic process
GO:0071840	0.680	cellular component organization or biogenesis
GO:0048523	0.677	negative regulation of cellular process
GO:0023051	0.675	regulation of signaling
GO:0010646	0.675	regulation of cell communication
GO:0016043	0.651	cellular component organization
GO:0009966	0.651	regulation of signal transduction
GO:0042221	0.624	response to chemical
GO:0051336	0.620	regulation of hydrolase activity
GO:0033554	0.610	cellular response to stress
GO:0031325	0.587	positive regulation of cellular metabolic process
GO:0097190	0.584	apoptotic signaling pathway
GO:0043170	0.578	macromolecule metabolic process
GO:0051345	0.573	positive regulation of hydrolase activity
GO:0052548	0.569	regulation of endopeptidase activity
GO:0065008	0.550	regulation of biological quality
GO:0070887	0.535	cellular response to chemical stimulus
GO:0007166	0.532	cell surface receptor signaling pathway
GO:0019538	0.496	protein metabolic process
GO:1902531	0.490	regulation of intracellular signal transduction
GO:2000116	0.483	regulation of cysteine-type endopeptidase activity
GO:0043281	0.470	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0051128	0.453	regulation of cellular component organization
GO:0009628	0.450	response to abiotic stimulus
GO:0006996	0.449	organelle organization
GO:0045862	0.431	positive regulation of proteolysis
GO:0010952	0.405	positive regulation of peptidase activity
GO:0043280	0.395	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0097193	0.392	intrinsic apoptotic signaling pathway
GO:0010033	0.375	response to organic substance
GO:0080134	0.375	regulation of response to stress
GO:0007005	0.368	mitochondrion organization
GO:0048584	0.360	positive regulation of response to stimulus
GO:0023056	0.356	positive regulation of signaling
GO:0097191	0.325	extrinsic apoptotic signaling pathway
GO:0051179	0.314	localization
GO:0044237	0.303	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0005829	0.988	cytosol
GO:0016020	0.958	membrane
GO:0032991	0.820	protein-containing complex
GO:0070013	0.463	intracellular organelle lumen
GO:0005634	0.462	nucleus
GO:0031090	0.319	organelle membrane
GO:0005740	0.314	mitochondrial envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]