StarFunc result for job id Q92935

User Input

>input (676 residues)
MQSWRRRKSLWLALSASWLLLVLLGGFSLLRLALPPRPRPGASQGWPRWLDAELLQSFSQ
PGELPEDAVSPPQAPHGGSCNWESCFDTSKCRGDGLKVFVYPAVGTISETHRRILASIEG
SRFYTFSPAGACLLLLLSLDAQTGECSSMPLQWNRGRNHLVLRLHPAPCPRTFQLGQAMV
AEASPTVDSFRPGFDVALPFLPEAHPLRGGAPGQLRQHSPQPGVALLALEEERGGWRTAD
TGSSACPWDGRCEQDPGPGQTQRQETLPNATFCLISGHRPEAASRFLQALQAGCIPVLLS
PRWELPFSEVIDWTKAAIVADERLPLQVLAALQEMSPARVLALRQQTQFLWDAYFSSVEK
VIHTTLEVIQDRIFGTSAHPSLLWNSPPGALLALSTFSTSPQDFPFYYLQQGSRPEGRFS
ALIWVGPPGQPPLKLIQAVAGSQHCAQILVLWSNERPLPSRWPETAVPLTVIDGHRKVSD
RFYPYSTIRTDAILSLDARSSLSTSEVDFAFLVWQSFPERMVGFLTSSHFWDEAHGGWGY
TAERTNEFSMVLTTAAFYHRYYHTLFTHSLPKALRTLADEAPTCVDVLMNFIVAAVTKLP
PIKVPYGKQRQEAAPLAPGGPGPRPKPPAPAPDCINQIAAAFGHMPLLSSRLRLDPVLFK
DPVSVQRKKYRSLEKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92935	1.000	1.000	0.000	676	1.000	1.000	Q92935.pdb.gz	EXTL1_HUMAN Exostosin-like 1 OS=Homo sapiens OX=9606 GN=EXTL1 PE=1 SV=2
2	AFDB:G3V901	0.763	0.694	1.375E-74	746	0.460	0.417	G3V901.pdb.gz	G3V901_RAT Exostosin glycosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ext1 PE=3 SV=1
3	AFDB:Q9V730	0.760	0.680	2.080E-65	760	0.411	0.366	Q9V730.pdb.gz	EXT1_DROME Exostosin-1 OS=Drosophila melanogaster OX=7227 GN=ttv PE=1 SV=1
4	PDB:7sckA	0.761	0.800	4.034E-65	642	0.436	0.460	7sckA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
5	PDB:7schA	0.719	0.802	4.106E-62	603	0.401	0.449	7schA.pdb.gz
6	PDB:7scjA	0.672	0.801	3.296E-55	563	0.371	0.446	7scjA.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
7	AFDB:O77783	0.376	0.356	3.679E-50	718	0.299	0.281	O77783.pdb.gz	EXT2_BOVIN Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1
8	AFDB:F1QUC2	0.374	0.353	5.956E-50	719	0.303	0.285	F1QUC2.pdb.gz
9	AFDB:Q9Y169	0.361	0.342	9.642E-50	717	0.303	0.286	Q9Y169.pdb.gz	EXT2_DROME Exostosin-2 OS=Drosophila melanogaster OX=7227 GN=sotv PE=1 SV=1
10	AFDB:Q5U7D2	0.485	0.383	7.059E-45	917	0.263	0.194	Q5U7D2.pdb.gz	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
11	AFDB:O43909	0.506	0.395	1.143E-44	919	0.271	0.199	O43909.pdb.gz	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
12	PDB:7sckB	0.446	0.491	1.964E-44	598	0.274	0.309	7sckB.pdb.gz	Structural basis for heparan sulfate co-polymerase action by the EXT1-2 complex.
13	PDB:7au2A	0.498	0.492	1.196E-43	686	0.254	0.251	7au2A.pdb.gz
14	AFDB:Q9XZ08	0.488	0.366	5.829E-40	972	0.262	0.182	Q9XZ08.pdb.gz	EXT3_DROME Exostosin-3 OS=Drosophila melanogaster OX=7227 GN=botv PE=1 SV=1
15	AFDB:O01705	0.481	0.415	5.767E-35	814	0.194	0.161	O01705.pdb.gz	EXT2_CAEEL Exostosin-2 homolog OS=Caenorhabditis elegans OX=6239 GN=rib-2 PE=1 SV=2
16	PDB:4fixA	0.204	0.218	9.295E-5	629	0.052	0.056	4fixA.pdb.gz	Tetrameric Structure of the GlfT2 Galactofuranosyltransferase Reveals a Scaffold for the Assembly of Mycobacterial Arabinogalactan.
17	PDB:6pxuB	0.179	0.223	3.496E-4	532	0.033	0.041	6pxuB.pdb.gz	The structure of the colorectal cancer-associated enzyme GalNAc-T12 reveals how nonconserved residues dictate its function.
18	PDB:2d7iA	0.185	0.226	9.164E-4	536	0.038	0.049	2d7iA.pdb.gz	Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
19	PDB:4d0tA	0.191	0.253	1.166E-3	496	0.030	0.040	4d0tA.pdb.gz	Substrate-Guided Front-Face Reaction Revealed by Combined Structural Snapshots and Metadynamics for the Polypeptide N-Acetylgalactosaminyltransferase 2.
20	PDB:6h0bB	0.177	0.222	2.129E-3	521	0.030	0.038	6h0bB.pdb.gz	Structural and Mechanistic Insights into the Catalytic-Domain-Mediated Short-Range Glycosylation Preferences of GalNAc-T4.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3V901	0.0	543	746	0.470	0.426	G3V901_RAT Exostosin glycosyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Ext1 PE=3 SV=1
2	P97464	0.0	543	746	0.470	0.426	EXT1_MOUSE Exostosin-1 OS=Mus musculus OX=10090 GN=Ext1 PE=1 SV=1
3	Q16394	0.0	543	746	0.469	0.425	EXT1_HUMAN Exostosin-1 OS=Homo sapiens OX=9606 GN=EXT1 PE=1 SV=2
4	Q92935	0.0	1368	676	1.000	1.000	EXTL1_HUMAN Exostosin-like 1 OS=Homo sapiens OX=9606 GN=EXTL1 PE=1 SV=2
5	Q3B8R0	5.20e-160	474	557	0.388	0.470	Q3B8R0_RAT Ext1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Ext1 PE=2 SV=1
6	Q9V730	4.99e-150	455	760	0.422	0.375	EXT1_DROME Exostosin-1 OS=Drosophila melanogaster OX=7227 GN=ttv PE=1 SV=1
7	Q5U7A7	6.37e-90	297	719	0.311	0.292	Q5U7A7_DANRE Exostosin-2 OS=Danio rerio OX=7955 GN=fc14g07 PE=1 SV=1
8	O77783	4.34e-87	290	718	0.291	0.274	EXT2_BOVIN Exostosin-2 OS=Bos taurus OX=9913 GN=EXT2 PE=1 SV=1
9	P70428	1.07e-85	286	718	0.293	0.276	EXT2_MOUSE Exostosin-2 OS=Mus musculus OX=10090 GN=Ext2 PE=1 SV=2
10	Q93063	1.78e-85	285	718	0.290	0.273	EXT2_HUMAN Exostosin-2 OS=Homo sapiens OX=9606 GN=EXT2 PE=1 SV=1
11	Q9Y169	2.21e-85	285	717	0.315	0.297	EXT2_DROME Exostosin-2 OS=Drosophila melanogaster OX=7227 GN=sotv PE=1 SV=1
12	Q5U7D2	1.17e-41	165	917	0.127	0.094	Q5U7D2_DANRE Exostoses (Multiple)-like 3 OS=Danio rerio OX=7955 GN=im:7141548 PE=1 SV=1
13	O43909	1.77e-41	164	919	0.129	0.095	EXTL3_HUMAN Exostosin-like 3 OS=Homo sapiens OX=9606 GN=EXTL3 PE=1 SV=1
14	Q9JMA8	1.32e-40	161	919	0.127	0.094	Q9JMA8_RAT Exostosin-like glycosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Extl3 PE=3 SV=1
15	Q9WVL6	1.62e-40	161	918	0.127	0.094	EXTL3_MOUSE Exostosin-like 3 OS=Mus musculus OX=10090 GN=Extl3 PE=1 SV=2
16	O01704	2.15e-40	154	382	0.157	0.277	EXT1_CAEEL Exostosin-1 homolog OS=Caenorhabditis elegans OX=6239 GN=rib-1 PE=1 SV=2
17	Q9XZ08	2.24e-34	142	972	0.129	0.090	EXT3_DROME Exostosin-3 OS=Drosophila melanogaster OX=7227 GN=botv PE=1 SV=1
18	O01705	6.39e-26	115	814	0.102	0.085	EXT2_CAEEL Exostosin-2 homolog OS=Caenorhabditis elegans OX=6239 GN=rib-2 PE=1 SV=2
19	Q9LY62	1.14e-23	104	334	0.086	0.174	GMT1_ARATH Glycosylinositol phosphorylceramide mannosyl transferase 1 OS=Arabidopsis thaliana OX=3702 GN=GMT1 PE=1 SV=1
20	A0A0G2K6F4	4.36e-20	97.4	845	0.135	0.108	A0A0G2K6F4_RAT Exostosin-like glycosyltransferase 3 OS=Rattus norvegicus OX=10116 GN=Extl3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03016 Exostosin	1.4e-28	111.7	Exostosin family
2	PF09258 Glyco_transf_64	2.7e-79	277.5	Glycosyl transferase family 64 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363398

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216037	0.900	X-box-binding protein 1
2	9606.ENSP00000220562	0.890	Exostosin-like 3
3	9606.ENSP00000246957	0.764	Heat shock protein 75 kDa, mitochondrial
4	9606.ENSP00000261858	0.659	D-glucuronyl C5-epimerase
5	9606.ENSP00000362136	0.603	Glycoprotein endo-alpha-1,2-mannosidase-like protein
6	9606.ENSP00000296499	0.599	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 3
7	9606.ENSP00000368496	0.584	Beta-1,3-galactosyltransferase 6
8	9606.ENSP00000264363	0.578	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
9	9606.ENSP00000265471	0.570	Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3
10	9606.ENSP00000261797	0.559	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
11	9606.ENSP00000310657	0.559	Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 2
12	9606.ENSP00000261381	0.556	Xylosyltransferase 1
13	9606.ENSP00000259241	0.554	Heparan-sulfate 6-O-sulfotransferase 1
14	9606.ENSP00000017003	0.536	Xylosyltransferase 2
15	9606.ENSP00000365895	0.531	Heparan-sulfate 6-O-sulfotransferase 3
16	9606.ENSP00000035307	0.528	Chondroitin sulfate glucuronyltransferase
17	9606.ENSP00000243776	0.527	Chondroitin sulfate synthase 2
18	9606.ENSP00000295731	0.525	Indian hedgehog protein
19	9606.ENSP00000359132	0.503	Exostosin-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008375	1.000	acetylglucosaminyltransferase activity
GO:0015020	0.946	glucuronosyltransferase activity
GO:0050508	0.772	glucuronosyl-N-acetylglucosaminyl-proteoglycan 4-alpha-N-acetylglucosaminyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030166	0.995	proteoglycan biosynthetic process
GO:0015012	0.994	heparan sulfate proteoglycan biosynthetic process
GO:0048856	0.976	anatomical structure development
GO:0048731	0.971	system development
GO:0001501	0.689	skeletal system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031090	0.999	organelle membrane
GO:0005783	0.997	endoplasmic reticulum
GO:0031984	0.967	organelle subcompartment
GO:0005794	0.953	Golgi apparatus
GO:0005789	0.936	endoplasmic reticulum membrane
GO:0098588	0.300	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.4.1.-	1.000	Hexosyltransferases.
RHEA:21032	0.946	glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP
EC:2.4.1.17	0.946	glucuronosyltransferase.
RHEA:16213	0.772	3-O-{[(1->4)-beta-D-GlcA-(1->4)-alpha-D-GlcNAc](n)-(1->4)-beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl}-L-seryl-[protein] + UDP-N-acetyl-alpha-D-glucosamine = 3-O-{alpha-D-GlcNAc-[(1->4)-beta-D-GlcA-(1->4)-alpha-D-GlcNAc](n)-(1->4)-beta-D-GlcA-(1->3)-beta-D-Gal-(1->3)-beta-D-Gal-(1->4)-beta-D-Xyl}-L-seryl-[protein] + H(+) + UDP
EC:2.4.1.224	0.772	acetylglucosaminyltransferase.

[back to server]