StarFunc result for job id Q92947

User Input

>input (438 residues)
MALRGVSVRLLSRGPGLHVLRTWVSSAAQTEKGGRTQSQLAKSSRPEFDWQDPLVLEEQL
TTDEILIRDTFRTYCQERLMPRILLANRNEVFHREIISEMGELGVLGPTIKGYGCAGVSS
VAYGLLARELERVDSGYRSAMSVQSSLVMHPIYAYGSEEQRQKYLPQLAKGELLGCFGLT
EPNSGSDPSSMETRAHYNSSNKSYTLNGTKTWITNSPMADLFVVWARCEDGCIRGFLLEK
GMRGLSAPRIQGKFSLRASATGMIIMDGVEVPEENVLPGASSLGGPFGCLNNARYGIAWG
VLGASEFCLHTARQYALDRMQFGVPLARNQLIQKKLADMLTEITLGLHACLQLGRLKDQD
KAAPEMVSLLKRNNCGKALDIARQARDMLGGNGISDEYHVIRHAMNLEAVNTYEGTHDIH
ALILGRAITGIQAFTASK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R7F9	0.927	0.927	7.908E-69	438	1.000	1.000	A0A024R7F9.pdb.gz
2	AFDB:Q60759	0.929	0.929	1.208E-64	438	0.870	0.870	Q60759.pdb.gz	GCDH_MOUSE Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gcdh PE=1 SV=2
3	PDB:2r0mA	0.889	0.999	3.922E-59	390	0.888	0.997	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.
4	AFDB:Q96329	0.862	0.866	5.633E-34	436	0.336	0.337	Q96329.pdb.gz	ACOX4_ARATH Acyl-coenzyme A oxidase 4, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX4 PE=1 SV=1
5	PDB:2ix6A	0.850	0.895	1.899E-32	416	0.320	0.337	2ix6A.pdb.gz	Controlling Electron Transfer in Acyl-Coa Oxidases and Dehydrogenases: A Structural View.
6	AFDB:Q9I296	0.822	0.928	9.029E-29	387	0.258	0.292	Q9I296.pdb.gz	Q9I296_PSEAE Isovaleryl-CoA dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuA PE=3 SV=1
7	PDB:1ivhA	0.829	0.936	1.325E-28	387	0.253	0.287	1ivhA.pdb.gz	Structure of human isovaleryl-CoA dehydrogenase at 2.6 A resolution: structural basis for substrate specificity,.
8	AFDB:G5EEH6	0.830	0.867	2.168E-28	419	0.281	0.294	G5EEH6.pdb.gz	G5EEH6_CAEEL Isovaleryl-CoA dehydrogenase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=ivd-1 PE=1 SV=1
9	AFDB:P12007	0.828	0.854	2.377E-28	424	0.274	0.283	P12007.pdb.gz	IVD_RAT Isovaleryl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ivd PE=1 SV=2
10	AFDB:Q3ZBF6	0.815	0.865	4.133E-28	412	0.276	0.294	Q3ZBF6.pdb.gz	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
11	AFDB:Q9VSA3	0.808	0.844	6.258E-28	419	0.281	0.294	Q9VSA3.pdb.gz	ACADM_DROME Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mcad PE=1 SV=1
12	AFDB:A0A0S2Z3P9	0.825	0.836	7.186E-28	432	0.272	0.275	A0A0S2Z3P9.pdb.gz	A0A0S2Z3P9_HUMAN Acyl-CoA dehydrogenase short/branched chain isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ACADSB PE=2 SV=1
13	AFDB:Q9SWG0	0.826	0.883	7.186E-28	409	0.263	0.281	Q9SWG0.pdb.gz	IVD_ARATH Isovaleryl-CoA dehydrogenase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=IVD PE=1 SV=2
14	PDB:1jqiA	0.809	0.921	1.328E-27	384	0.274	0.312	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
15	PDB:1rx0A	0.816	0.928	1.059E-25	384	0.226	0.258	1rx0A.pdb.gz	Structures of Isobutyryl-CoA Dehydrogenase and Enzyme-Product Complex: COMPARISON WITH ISOVALERYL- AND SHORT-CHAIN ACYL-COA DEHYDROGENASES.
16	PDB:7s7gA	0.781	0.605	2.542E-25	571	0.258	0.198	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
17	PDB:2a1tC	0.809	0.911	5.315E-25	388	0.240	0.271	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
18	PDB:6fahC	0.809	0.931	1.061E-24	379	0.260	0.301	6fahC.pdb.gz	Molecular basis of the flavin-based electron-bifurcating caffeyl-CoA reductase reaction.
19	PDB:6af6A	0.782	0.891	6.722E-23	383	0.208	0.238	6af6A.pdb.gz	Crystal Structure of PigA: A Prolyl Thioester-Oxidizing Enzyme in Prodigiosin Biosynthesis.
20	PDB:4xvxB	0.762	0.889	7.435E-19	373	0.158	0.185	4xvxB.pdb.gz	A covalent adduct of MbtN, an acyl-ACP dehydrogenase from Mycobacterium tuberculosis, reveals an unusual acyl-binding pocket.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZN89	0.0	778	438	0.868	0.868	A0A8I5ZN89_RAT Glutaryl-CoA dehydrogenase OS=Rattus norvegicus OX=10116 GN=Gcdh PE=1 SV=1
2	A0A8I5ZUK9	0.0	691	425	0.797	0.821	A0A8I5ZUK9_RAT Glutaryl-CoA dehydrogenase OS=Rattus norvegicus OX=10116 GN=Gcdh PE=1 SV=1
3	D3ZT90	0.0	738	425	0.822	0.847	D3ZT90_RAT Glutaryl-CoA dehydrogenase OS=Rattus norvegicus OX=10116 GN=Gcdh PE=3 SV=2
4	Q60759	0.0	786	438	0.870	0.870	GCDH_MOUSE Glutaryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Gcdh PE=1 SV=2
5	Q92947	0.0	907	438	1.000	1.000	GCDH_HUMAN Glutaryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GCDH PE=1 SV=1
6	K7EKT3	7.73e-112	327	164	0.372	0.994	K7EKT3_HUMAN Glutaryl-CoA dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=GCDH PE=1 SV=1
7	K7ES74	8.20e-75	231	131	0.256	0.855	K7ES74_HUMAN Glutaryl-CoA dehydrogenase (Fragment) OS=Homo sapiens OX=9606 GN=GCDH PE=1 SV=1
8	Q96329	1.42e-70	231	436	0.320	0.321	ACOX4_ARATH Acyl-coenzyme A oxidase 4, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX4 PE=1 SV=1
9	Q07417	6.68e-51	179	412	0.272	0.289	ACADS_MOUSE Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Acads PE=1 SV=2
10	P15651	3.94e-50	177	412	0.269	0.286	ACADS_RAT Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Acads PE=1 SV=2
11	E5KSD5	5.28e-50	176	412	0.269	0.286	E5KSD5_HUMAN Acyl-Coenzyme A dehydrogenase, C-2 to C-3 short chain OS=Homo sapiens OX=9606 GN=ACADS PE=3 SV=1
12	P16219	5.28e-50	176	412	0.269	0.286	ACADS_HUMAN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1
13	Q9I296	1.22e-46	167	387	0.253	0.287	Q9I296_PSEAE Isovaleryl-CoA dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuA PE=3 SV=1
14	Q9VVU1	2.03e-46	167	414	0.256	0.271	Q9VVU1_DROME FI09602p OS=Drosophila melanogaster OX=7227 GN=GH07925p PE=1 SV=1
15	Q3ZBF6	3.74e-46	166	412	0.256	0.272	ACADS_BOVIN Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Bos taurus OX=9913 GN=ACADS PE=1 SV=1
16	Q95U46	3.98e-46	166	414	0.256	0.271	Q95U46_DROME GH07925p OS=Drosophila melanogaster OX=7227 GN=CG3902 PE=2 SV=1
17	Q9JHI5	3.50e-45	164	424	0.267	0.276	IVD_MOUSE Isovaleryl-CoA dehydrogenase, mitochondrial OS=Mus musculus OX=10090 GN=Ivd PE=1 SV=1
18	G3KIM8	4.39e-45	163	394	0.258	0.287	ACRC_ANAPI Acryloyl-CoA reductase (NADH) OS=Anaerotignum propionicum OX=28446 GN=acrC PE=1 SV=1
19	Q9VSA3	1.55e-44	162	419	0.272	0.284	ACADM_DROME Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Drosophila melanogaster OX=7227 GN=Mcad PE=1 SV=1
20	Q9FS88	2.37e-44	161	412	0.258	0.274	MBCD_SOLTU 2-methylacyl-CoA dehydrogenase, mitochondrial OS=Solanum tuberosum OX=4113 GN=2MBCD PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00441 Acyl-CoA_dh_1	8.7e-24	95.9	Acyl-CoA dehydrogenase, C-terminal domain
2	PF08028 Acyl-CoA_dh_2	0.21	23.2	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	2.4e-17	74.2	Acyl-CoA dehydrogenase, middle domain
4	PF02771 Acyl-CoA_dh_N	6.9e-25	99.3	Acyl-CoA dehydrogenase, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222214

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357535	0.967	Enoyl-CoA hydratase, mitochondrial
2	9606.ENSP00000263035	0.958	Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial
3	9606.ENSP00000231887	0.957	Peroxisomal bifunctional enzyme
4	9606.ENSP00000370023	0.955	Trifunctional enzyme subunit alpha, mitochondrial
5	9606.ENSP00000205402	0.953	Dihydrolipoyl dehydrogenase, mitochondrial
6	9606.ENSP00000293217	0.947	Peroxisomal acyl-coenzyme A oxidase 1
7	9606.ENSP00000357873	0.946	Short/branched chain specific acyl-CoA dehydrogenase, mitochondrial
8	9606.ENSP00000335304	0.934	Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
9	9606.ENSP00000348775	0.931	Peroxisomal acyl-coenzyme A oxidase 3
10	9606.ENSP00000242592	0.924	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
11	9606.ENSP00000346173	0.876	Electron transfer flavoprotein subunit beta
12	9606.ENSP00000426638	0.764	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
13	9606.ENSP00000452762	0.752	Electron transfer flavoprotein subunit alpha, mitochondrial
14	9606.ENSP00000218006	0.746	Retinal guanylyl cyclase 2
15	9606.ENSP00000394842	0.655	Grancalcin
16	9606.ENSP00000299138	0.649	Vacuolar protein sorting-associated protein 35
17	9606.ENSP00000357669	0.640	Atrial natriuretic peptide receptor 1
18	9606.ENSP00000338475	0.639	Succinate--hydroxymethylglutarate CoA-transferase
19	9606.ENSP00000369461	0.638	Enoyl-CoA delta isomerase 2, mitochondrial
20	9606.ENSP00000254854	0.630	Retinal guanylyl cyclase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003995	0.999	acyl-CoA dehydrogenase activity
GO:0005488	0.998	binding
GO:0043168	0.984	anion binding
GO:0097159	0.983	organic cyclic compound binding
GO:0036094	0.982	small molecule binding
GO:1901363	0.950	heterocyclic compound binding
GO:0005515	0.815	protein binding
GO:0050660	0.803	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.997	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.997	cellular metabolic process
GO:0044281	0.996	small molecule metabolic process
GO:0044255	0.994	cellular lipid metabolic process
GO:0032787	0.985	monocarboxylic acid metabolic process
GO:0034440	0.982	lipid oxidation
GO:0019395	0.965	fatty acid oxidation
GO:0009062	0.937	fatty acid catabolic process
GO:0006635	0.914	fatty acid beta-oxidation
GO:0006807	0.632	nitrogen compound metabolic process
GO:1901564	0.612	organonitrogen compound metabolic process
GO:0034641	0.370	cellular nitrogen compound metabolic process
GO:1901360	0.369	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.945	intracellular organelle lumen
GO:0005759	0.797	mitochondrial matrix
GO:0016020	0.309	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	0.999	Acting on the CH-CH group of donors.

[back to server]