StarFunc result for job id Q92952

User Input

>input (543 residues)
MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR
GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV
MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA
MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL
LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT
VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL
VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV
RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA
RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS
DCG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92952	1.000	1.000	1.227E-70	543	1.000	1.000	Q92952.pdb.gz	KCNN1_HUMAN Small conductance calcium-activated potassium channel protein 1 OS=Homo sapiens OX=9606 GN=KCNN1 PE=1 SV=2
2	AFDB:Q9EQR3	0.838	0.847	1.083E-60	537	0.834	0.844	Q9EQR3.pdb.gz	KCNN1_MOUSE Small conductance calcium-activated potassium channel protein 1 OS=Mus musculus OX=10090 GN=Kcnn1 PE=1 SV=2
3	AFDB:P58391	0.759	0.572	2.846E-51	732	0.665	0.493	P58391.pdb.gz	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
4	AFDB:Q7KVW5	0.741	0.441	5.235E-43	927	0.541	0.317	Q7KVW5.pdb.gz	KCNN_DROME Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2
5	AFDB:V6CLK4	0.698	0.450	6.409E-33	855	0.398	0.253	V6CLK4.pdb.gz	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1
6	AFDB:O15554	0.603	0.759	4.319E-29	427	0.344	0.438	O15554.pdb.gz	KCNN4_HUMAN Intermediate conductance calcium-activated potassium channel protein 4 OS=Homo sapiens OX=9606 GN=KCNN4 PE=1 SV=1
7	AFDB:O89109	0.668	0.843	1.150E-28	425	0.346	0.442	O89109.pdb.gz	KCNN4_MOUSE Intermediate conductance calcium-activated potassium channel protein 4 OS=Mus musculus OX=10090 GN=Kcnn4 PE=2 SV=1
8	PDB:6cnnA	0.588	0.868	1.002E-24	360	0.315	0.475	6cnnA.pdb.gz	Activation mechanism of a human SK-calmodulin channel complex elucidated by cryo-EM structures.
9	AFDB:D1MQ08	0.399	0.699	5.514E-16	295	0.227	0.417	D1MQ08.pdb.gz	D1MQ08_HUMAN Small conductance calcium activated potassium channel type 4 transcript variant 2 OS=Homo sapiens OX=9606 GN=KCNN4 PE=2 SV=1
10	PDB:7bylA	0.165	0.245	4.335E-6	354	0.123	0.189	7bylA.pdb.gz	Structural Basis for the Modulation of Human KCNQ4 by Small-Molecule Drugs.
11	AFDB:O88944	0.186	0.132	5.870E-6	873	0.173	0.108	O88944.pdb.gz	KCNQ3_RAT Potassium voltage-gated channel subfamily KQT member 3 OS=Rattus norvegicus OX=10116 GN=Kcnq3 PE=1 SV=2
12	PDB:7vnrA	0.184	0.262	3.221E-5	333	0.112	0.183	7vnrA.pdb.gz	Structural insights into the lipid and ligand regulation of a human neuronal KCNQ channel.
13	PDB:7w6sB	0.178	0.213	1.246E-4	448	0.123	0.150	7w6sB.pdb.gz
14	PDB:7f3fA	0.175	0.203	7.332E-4	460	0.103	0.122	7f3fA.pdb.gz
15	AFDB:A0A2R8QRD5	0.259	0.151	7.504E-4	1065	0.122	0.062	A0A2R8QRD5.pdb.gz
16	PDB:7phhA	0.137	0.184	9.699E-4	396	0.092	0.126	7phhA.pdb.gz
17	PDB:7sizB	0.151	0.240	5.981E-3	334	0.076	0.123	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
18	PDB:1f6gA	0.148	0.434	1.385E-2	160	0.048	0.163	1f6gA.pdb.gz
19	PDB:2a79B	0.149	0.299	1.520E-2	259	0.070	0.147	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
20	PDB:7pquA	0.151	0.243	1.520E-2	328	0.083	0.137	7pquA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58390	0.0	739	839	0.645	0.417	KCNN2_MOUSE Small conductance calcium-activated potassium channel protein 2 OS=Mus musculus OX=10090 GN=Kcnn2 PE=1 SV=2
2	P58391	0.0	727	732	0.630	0.467	KCNN3_MOUSE Small conductance calcium-activated potassium channel protein 3 OS=Mus musculus OX=10090 GN=Kcnn3 PE=1 SV=2
3	P70604	0.0	745	580	0.645	0.603	KCNN2_RAT Small conductance calcium-activated potassium channel protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnn2 PE=1 SV=1
4	P70605	0.0	726	732	0.630	0.467	KCNN3_RAT Small conductance calcium-activated potassium channel protein 3 OS=Rattus norvegicus OX=10116 GN=Kcnn3 PE=2 SV=3
5	P70606	0.0	883	536	0.829	0.840	KCNN1_RAT Small conductance calcium-activated potassium channel protein 1 OS=Rattus norvegicus OX=10116 GN=Kcnn1 PE=1 SV=2
6	Q7KVW5	0.0	583	927	0.514	0.301	KCNN_DROME Small conductance calcium-activated potassium channel protein OS=Drosophila melanogaster OX=7227 GN=SK PE=2 SV=2
7	Q92952	0.0	1125	543	1.000	1.000	KCNN1_HUMAN Small conductance calcium-activated potassium channel protein 1 OS=Homo sapiens OX=9606 GN=KCNN1 PE=1 SV=2
8	Q9EQR3	0.0	880	537	0.831	0.840	KCNN1_MOUSE Small conductance calcium-activated potassium channel protein 1 OS=Mus musculus OX=10090 GN=Kcnn1 PE=1 SV=2
9	Q9H2S1	0.0	746	579	0.645	0.604	KCNN2_HUMAN Small conductance calcium-activated potassium channel protein 2 OS=Homo sapiens OX=9606 GN=KCNN2 PE=1 SV=2
10	Q9UGI6	0.0	729	731	0.672	0.499	KCNN3_HUMAN Small conductance calcium-activated potassium channel protein 3 OS=Homo sapiens OX=9606 GN=KCNN3 PE=1 SV=2
11	V6CLK4	6.81e-129	398	855	0.378	0.240	V6CLK4_CAEEL Calmodulin-binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=kcnl-2 PE=4 SV=1
12	O89109	1.28e-100	312	425	0.350	0.447	KCNN4_MOUSE Intermediate conductance calcium-activated potassium channel protein 4 OS=Mus musculus OX=10090 GN=Kcnn4 PE=2 SV=1
13	Q9QYW1	1.04e-99	310	425	0.343	0.438	KCNN4_RAT Intermediate conductance calcium-activated potassium channel protein 4 OS=Rattus norvegicus OX=10116 GN=Kcnn4 PE=2 SV=2
14	O15554	1.30e-98	307	427	0.350	0.445	KCNN4_HUMAN Intermediate conductance calcium-activated potassium channel protein 4 OS=Homo sapiens OX=9606 GN=KCNN4 PE=1 SV=1
15	D1MQ08	1.15e-65	217	295	0.230	0.424	D1MQ08_HUMAN Small conductance calcium activated potassium channel type 4 transcript variant 2 OS=Homo sapiens OX=9606 GN=KCNN4 PE=2 SV=1
16	A1Z856	5.15e-07	55.1	993	0.070	0.038	A1Z856_DROME KCNQ potassium channel, isoform F OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=2
17	A0A0B4KEI9	7.96e-07	54.3	823	0.070	0.046	A0A0B4KEI9_DROME KCNQ potassium channel, isoform H OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
18	A0A0B4KEP9	9.15e-07	54.3	827	0.070	0.046	A0A0B4KEP9_DROME KCNQ potassium channel, isoform J OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
19	A0A0B4KFJ4	9.21e-07	54.3	781	0.070	0.049	A0A0B4KFJ4_DROME KCNQ potassium channel, isoform K OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1
20	B7YZR4	9.21e-07	54.3	683	0.070	0.056	B7YZR4_DROME KCNQ potassium channel, isoform C OS=Drosophila melanogaster OX=7227 GN=KCNQ PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02888 CaMBD	2.1e-30	115.8	Calmodulin binding domain
2	PF05746 DALR_1	3.2e+02	12.9	DALR anticodon binding domain
3	PF07885 Ion_trans_2	8.6e-10	49.8	Ion channel
4	PF06009 Laminin_II	4e+02	12.4	Laminin Domain II
5	PF02403 Seryl_tRNA_N	1.8e+02	13.7	Seryl-tRNA synthetase N-terminal domain
6	PF03530 SK_channel	7.8e-45	163.1	Calcium-activated SK potassium channel

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000476519

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000286628	0.952	Calcium-activated potassium channel subunit alpha-1
2	9606.ENSP00000382770	0.921	Potassium channel subfamily U member 1
3	9606.ENSP00000274629	0.890	Calcium-activated potassium channel subunit beta-1
4	9606.ENSP00000407592	0.877	Potassium large conductance calcium-activated channel, subfamily M, beta member 2
5	9606.ENSP00000258111	0.862	Calcium-activated potassium channel subunit beta-4
6	9606.ENSP00000319370	0.862	Calcium-activated potassium channel subunit beta-3
7	9606.ENSP00000262888	0.814	Intermediate conductance calcium-activated potassium channel protein 4
8	9606.ENSP00000481848	0.811	Small conductance calcium-activated potassium channel protein 3
9	9606.ENSP00000427120	0.809	Small conductance calcium-activated potassium channel protein 2
10	9606.ENSP00000304822	0.718	Kappa-casein
11	9606.ENSP00000263431	0.683	Protein kinase C gamma type
12	9606.ENSP00000360822	0.652	Potassium channel subfamily T member 1
13	9606.ENSP00000305355	0.650	Protein kinase C beta type
14	9606.ENSP00000294725	0.644	Potassium channel subfamily T member 2
15	9606.ENSP00000431404	0.641	PiggyBac transposable element-derived protein 5
16	9606.ENSP00000408695	0.639	Protein kinase C alpha type
17	9606.ENSP00000384160	0.627	RNA-binding protein 33
18	9606.ENSP00000342313	0.620	Sterile alpha motif domain-containing protein 11
19	9606.ENSP00000470152	0.615	Dystrobrevin alpha
20	9606.ENSP00000262186	0.542	Potassium voltage-gated channel subfamily H member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015269	1.000	calcium-activated potassium channel activity
GO:0005249	0.998	voltage-gated potassium channel activity
GO:0005515	0.997	protein binding
GO:0099094	0.926	ligand-gated monoatomic cation channel activity
GO:0005242	0.911	inward rectifier potassium channel activity
GO:0016286	0.841	small conductance calcium-activated potassium channel activity
GO:0044877	0.301	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.997	transport
GO:0009987	0.991	cellular process
GO:0006813	0.988	potassium ion transport
GO:0071805	0.958	potassium ion transmembrane transport
GO:0007267	0.866	cell-cell signaling
GO:0007268	0.858	chemical synaptic transmission
GO:0065007	0.705	biological regulation
GO:0050789	0.507	regulation of biological process
GO:0050794	0.328	regulation of cellular process
GO:0032501	0.324	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0032991	0.997	protein-containing complex
GO:0034703	0.992	cation channel complex
GO:0034705	0.947	potassium channel complex
GO:0098797	0.919	plasma membrane protein complex
GO:0008076	0.890	voltage-gated potassium channel complex
GO:0005622	0.792	intracellular anatomical structure
GO:0005737	0.692	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29463	1.000	K(+)(in) = K(+)(out)

[back to server]