StarFunc result for job id Q92954

User Input

>input (1404 residues)
MAWKTLPIYLLLLLSVFVIQQVSSQDLSSCAGRCGEGYSRDATCNCDYNCQHYMECCPDF
KRVCTAELSCKGRCFESFERGRECDCDAQCKKYDKCCPDYESFCAEVHNPTSPPSSKKAP
PPSGASQTIKSTTKRSPKPPNKKKTKKVIESEEITEEHSVSENQESSSSSSSSSSSSTIR
KIKSSKNSAANRELQKKLKVKDNKKNRTKKKPTPKPPVVDEAGSGLDNGDFKVTTPDTST
TQHNKVSTSPKITTAKPINPRPSLPPNSDTSKETSLTVNKETTVETKETTTTNKQTSTDG
KEKTTSAKETQSIEKTSAKDLAPTSKVLAKPTPKAETTTKGPALTTPKEPTPTTPKEPAS
TTPKEPTPTTIKSAPTTPKEPAPTTTKSAPTTPKEPAPTTTKEPAPTTPKEPAPTTTKEP
APTTTKSAPTTPKEPAPTTPKKPAPTTPKEPAPTTPKEPTPTTPKEPAPTTKEPAPTTPK
EPAPTAPKKPAPTTPKEPAPTTPKEPAPTTTKEPSPTTPKEPAPTTTKSAPTTTKEPAPT
TTKSAPTTPKEPSPTTTKEPAPTTPKEPAPTTPKKPAPTTPKEPAPTTPKEPAPTTTKKP
APTTPKEPAPTTPKETAPTTPKKLTPTTPEKLAPTTPEKPAPTTPEELAPTTPEEPTPTT
PEEPAPTTPKAAAPNTPKEPAPTTPKEPAPTTPKEPAPTTPKETAPTTPKGTAPTTLKEP
APTTPKKPAPKELAPTTTKEPTSTTSDKPAPTTPKGTAPTTPKEPAPTTPKEPAPTTPKG
TAPTTLKEPAPTTPKKPAPKELAPTTTKGPTSTTSDKPAPTTPKETAPTTPKEPAPTTPK
KPAPTTPETPPPTTSEVSTPTTTKEPTTIHKSPDESTPELSAEPTPKALENSPKEPGVPT
TKTPAATKPEMTTTAKDKTTERDLRTTPETTTAAPKMTKETATTTEKTTESKITATTTQV
TSTTTQDTTPFKITTLKTTTLAPKVTTTKKTITTTEIMNKPEETAKPKDRATNSKATTPK
PQKPTKAPKKPTSTKKPKTMPRVRKPKTTPTPRKMTSTMPELNPTSRIAEAMLQTTTRPN
QTPNSKLVEVNPKSEDAGGAEGETPHMLLRPHVFMPEVTPDMDYLPRVPNQGIIINPMLS
DETNICNGKPVDGLTTLRNGTLVAFRGHYFWMLSPFSPPSPARRITEVWGIPSPIDTVFT
RCNCEGKTFFFKDSQYWRFTNDIKDAGYPKPIFKGFGGLTGQIVAALSTAKYKNWPESVY
FFKRGGSIQQYIYKQEPVQKCPGRRPALNYPVYGETTQVRRRRFERAIGPSQTHTIRIQY
SPARLAYQDKGVLHNEVKVSILWRGLPNVVTSAISLPNIRKPDGYDYYAFSKDQYYNIDV
PSRTARAITTRSGQTLSKVWYNCP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92954	1.000	1.000	0.000	1404	1.000	1.000	Q92954.pdb.gz	PRG4_HUMAN Proteoglycan 4 OS=Homo sapiens OX=9606 GN=PRG4 PE=1 SV=3
2	AFDB:Q9JM99	0.216	0.281	5.937E-84	1054	0.569	0.758	Q9JM99.pdb.gz	PRG4_MOUSE Proteoglycan 4 OS=Mus musculus OX=10090 GN=Prg4 PE=1 SV=2
3	PDB:1su3B	0.117	0.374	1.344E-10	416	0.034	0.115	1su3B.pdb.gz	X-ray structure of human proMMP-1: new insights into procollagenase activation and collagen binding.
4	PDB:1gxdA	0.116	0.251	7.145E-10	624	0.031	0.069	1gxdA.pdb.gz	Structural Insight Into the Complex Formation of Latent Matrix Metalloproteinase 2 with Tissue Inhibitor of Metalloproteinase 2
5	PDB:5a2qg	0.089	0.303	4.059E-5	314	0.014	0.064	5a2qg.pdb.gz	Cryo-Em Structure of Hepatitis C Virus Ires Bound to the Human Ribosome at 3.9 Angstrom Resolution
6	PDB:5wyjBE	0.091	0.154	5.736E-5	753	0.019	0.035	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
7	PDB:7d5sBE	0.089	0.135	1.021E-4	865	0.019	0.030	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
8	PDB:1nr0A	0.090	0.181	1.213E-4	610	0.019	0.043	1nr0A.pdb.gz
9	PDB:7d4iBE	0.087	0.129	1.714E-4	890	0.020	0.031	7d4iBE.pdb.gz	Cryo-EM structure of 90S small ribosomal precursors complex with Dhr1
10	PDB:7pzyh	0.086	0.294	1.816E-4	311	0.016	0.074	7pzyh.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
11	PDB:3dm0A	0.088	0.163	2.158E-4	675	0.015	0.031	3dm0A.pdb.gz	Structure of a signal transduction regulator, RACK1, from Arabidopsis thaliana.
12	PDB:7bt6x	0.083	0.193	2.718E-4	488	0.018	0.051	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	AFDB:Q9H2Y7	0.077	0.062	1.580E-3	1883	0.130	0.097	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
14	AFDB:O88466	0.072	0.056	1.058E-2	1888	0.147	0.109	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
15	AFDB:Q3U0P1	0.075	0.092	1.257E-2	1104	0.088	0.111	Q3U0P1.pdb.gz	PALB2_MOUSE Partner and localizer of BRCA2 OS=Mus musculus OX=10090 GN=Palb2 PE=1 SV=2
16	AFDB:B7YZK8	0.098	0.092	1.498E-1	1517	0.091	0.084	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
17	AFDB:O35413	0.042	0.046	1.587E-1	1196	0.098	0.115	O35413.pdb.gz	SRBS2_RAT Sorbin and SH3 domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Sorbs2 PE=1 SV=2
18	AFDB:A0A1D5NS76	0.034	0.026	1.998E-1	2005	0.124	0.087	A0A1D5NS76.pdb.gz
19	AFDB:Q62417	0.038	0.042	2.116E-1	1290	0.125	0.136	Q62417.pdb.gz	SRBS1_MOUSE Sorbin and SH3 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Sorbs1 PE=1 SV=2
20	AFDB:Q924C5	0.039	0.035	2.375E-1	1678	0.126	0.105	Q924C5.pdb.gz	ALPK3_MOUSE Alpha-protein kinase 3 OS=Mus musculus OX=10090 GN=Alpk3 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92954	0.0	2654	1404	1.000	1.000	PRG4_HUMAN Proteoglycan 4 OS=Homo sapiens OX=9606 GN=PRG4 PE=1 SV=3
2	Q9JM99	0.0	591	1054	0.197	0.262	PRG4_MOUSE Proteoglycan 4 OS=Mus musculus OX=10090 GN=Prg4 PE=1 SV=2
3	P29788	8.05e-31	130	478	0.052	0.153	VTNC_MOUSE Vitronectin OS=Mus musculus OX=10090 GN=Vtn PE=1 SV=2
4	Q3KR94	8.08e-30	127	478	0.052	0.153	Q3KR94_RAT Vitronectin OS=Rattus norvegicus OX=10116 GN=Vtn PE=2 SV=1
5	D9ZGG2	8.31e-30	127	478	0.047	0.138	D9ZGG2_HUMAN Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=4 SV=1
6	P04004	8.31e-30	127	478	0.047	0.138	VTNC_HUMAN Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=1
7	Q7TQ11	4.65e-27	119	490	0.052	0.149	Q7TQ11_RAT Aa1018 OS=Rattus norvegicus OX=10116 GN=Vtn PE=1 SV=1
8	P48819	1.85e-25	114	459	0.046	0.139	VTNC_PIG Vitronectin OS=Sus scrofa OX=9823 GN=VTN PE=1 SV=1
9	M9PCJ6	1.49e-20	102	18641	0.105	0.008	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PC48	1.74e-20	101	18095	0.105	0.008	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	P21128	6.99e-20	96.3	410	0.029	0.100	ENDOU_HUMAN Uridylate-specific endoribonuclease OS=Homo sapiens OX=9606 GN=ENDOU PE=1 SV=2
12	G4SLH0	1.43e-14	82.4	18562	0.130	0.010	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
13	Q9QXJ2	4.72e-14	79.7	922	0.036	0.054	Q9QXJ2_MOUSE Signal transducer and activator of transcription OS=Mus musculus OX=10090 GN=Stat2 PE=1 SV=1
14	Q9WVL2	4.72e-13	76.6	923	0.035	0.053	STAT2_MOUSE Signal transducer and activator of transcription 2 OS=Mus musculus OX=10090 GN=Stat2 PE=1 SV=1
15	E9QAQ8	4.96e-12	73.6	3455	0.084	0.034	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
16	A0A0B4JDA7	1.47e-09	64.7	554	0.031	0.079	A0A0B4JDA7_DROME Matrix metalloproteinase 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1
17	Q9W122	1.60e-09	64.7	584	0.032	0.077	Q9W122_DROME Matrix metalloproteinase 1, isoform C OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=2 SV=3
18	A0A0B4K7H5	3.42e-09	63.5	512	0.031	0.086	A0A0B4K7H5_DROME Matrix metalloproteinase 1, isoform J OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1
19	Q9GTK3	3.42e-09	63.5	567	0.031	0.078	Q9GTK3_DROME Matrix metalloproteinase 1 OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=2 SV=1
20	A0A0B4JCU7	4.04e-09	63.2	542	0.031	0.081	A0A0B4JCU7_DROME Matrix metalloproteinase 1, isoform E OS=Drosophila melanogaster OX=7227 GN=Mmp1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00045 Hemopexin	2.3e-10	51.6	Hemopexin
2	PF01033 Somatomedin_B	2e-17	74.6	Somatomedin B domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399679

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000398632	0.843	CD44 antigen
2	9606.ENSP00000236147	0.804	L-selectin
3	9606.ENSP00000387356	0.793	Aggrecan core protein
4	9606.ENSP00000265983	0.741	Hemopexin
5	9606.ENSP00000222271	0.718	Cartilage oligomeric matrix protein
6	9606.ENSP00000261883	0.667	Cartilage intermediate layer protein 1
7	9606.ENSP00000369889	0.650	Collagen alpha-1(II) chain
8	9606.ENSP00000379934	0.636	Probable palmitoyltransferase ZDHHC4
9	9606.ENSP00000245479	0.619	Transcription factor SOX-9
10	9606.ENSP00000312506	0.609	Chondroitin sulfate proteoglycan 4
11	9606.ENSP00000327368	0.592	Collagen alpha-1(X) chain
12	9606.ENSP00000362870	0.590	Cartilage matrix protein
13	9606.ENSP00000363492	0.574	Growth/differentiation factor 5
14	9606.ENSP00000284987	0.567	A disintegrin and metalloproteinase with thrombospondin motifs 5
15	9606.ENSP00000260302	0.565	Collagenase 3
16	9606.ENSP00000265077	0.539	Versican core protein
17	9606.ENSP00000477949	0.539	Transmembrane protease serine 4
18	9606.ENSP00000434279	0.538	Transmembrane protease serine 13
19	9606.ENSP00000347041	0.523	Fibromodulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.691	protein-containing complex binding
GO:0097159	0.352	organic cyclic compound binding
GO:1901363	0.349	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.991	developmental process
GO:0009987	0.987	cellular process
GO:0032501	0.970	multicellular organismal process
GO:0048856	0.952	anatomical structure development
GO:0065007	0.935	biological regulation
GO:0050789	0.934	regulation of biological process
GO:0050794	0.887	regulation of cellular process
GO:0000003	0.813	reproduction
GO:0048519	0.737	negative regulation of biological process
GO:0019222	0.592	regulation of metabolic process
GO:0060255	0.576	regulation of macromolecule metabolic process
GO:0022414	0.537	reproductive process
GO:0048869	0.494	cellular developmental process
GO:0030154	0.462	cell differentiation
GO:0050896	0.378	response to stimulus
GO:0051239	0.356	regulation of multicellular organismal process
GO:0010468	0.344	regulation of gene expression
GO:0009892	0.305	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0062023	0.996	collagen-containing extracellular matrix
GO:0005615	0.732	extracellular space
GO:0070013	0.480	intracellular organelle lumen
GO:0012505	0.455	endomembrane system
GO:0042600	0.390	egg chorion
GO:0043227	0.384	membrane-bounded organelle
GO:0043231	0.371	intracellular membrane-bounded organelle
GO:0005737	0.322	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]