StarFunc result for job id Q92956

User Input

>input (283 residues)
MEPPGDWGPPPWRSTPKTDVLRLVLYLTFLGAPCYAPALPSCKEDEYPVGSECCPKCSPG
YRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCG
CSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQ
HQTKCSWLVTKAGAGTSSSHWVWWFLSGSLVIVIVCSTVGLIICVKRRKPRGDVVKVIVS
VQRKRQEAEGEATVIEALQAPPDVTTVAVEETIPSFTGRSPNH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92956	1.000	1.000	2.592E-50	283	1.000	1.000	Q92956.pdb.gz	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
2	AFDB:Q71F55	0.428	0.437	2.035E-26	276	0.435	0.446	Q71F55.pdb.gz	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
3	AFDB:P27512	0.376	0.369	8.063E-17	289	0.219	0.215	P27512.pdb.gz	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
4	AFDB:Q4QQW2	0.359	0.352	9.583E-17	289	0.240	0.235	Q4QQW2.pdb.gz
5	AFDB:P25942	0.349	0.356	1.703E-15	277	0.233	0.238	P25942.pdb.gz	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
6	AFDB:Q9Y6Q6	0.337	0.176	6.399E-15	616	0.223	0.102	Q9Y6Q6.pdb.gz	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
7	AFDB:F1RAS9	0.424	0.293	6.778E-15	425	0.286	0.191	F1RAS9.pdb.gz	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
8	AFDB:F1M8Z6	0.339	0.172	1.014E-14	633	0.240	0.107	F1M8Z6.pdb.gz	F1M8Z6_RAT TNF receptor superfamily member 11A OS=Rattus norvegicus OX=10116 GN=Tnfrsf11a PE=4 SV=2
9	AFDB:B8X730	0.398	0.395	2.698E-14	286	0.244	0.241	B8X730.pdb.gz	B8X730_DANRE CD40 molecule, TNF receptor superfamily member 5 OS=Danio rerio OX=7955 GN=si:ch211-231h20.3 PE=2 SV=1
10	AFDB:P50284	0.340	0.252	6.396E-14	415	0.251	0.171	P50284.pdb.gz	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
11	PDB:7wihA	0.149	0.070	4.888E-1	741	0.092	0.035	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
12	PDB:7e9hR	0.134	0.059	5.178E-1	766	0.074	0.027	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
13	PDB:8a7dQ	0.093	0.096	5.809E-1	273	0.092	0.095	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
14	PDB:7ufgA	0.139	0.049	7.746E-1	1151	0.088	0.022	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
15	PDB:7dtvA	0.150	0.069	9.206E-1	779	0.088	0.032	7dtvA.pdb.gz	Structural mechanism of cooperative activation of the human calcium-sensing receptor by Ca 2+ ions and L-tryptophan.
16	PDB:6xt9I	0.075	0.039	1.094	767	0.046	0.017	6xt9I.pdb.gz
17	PDB:5yzgY	0.121	0.156	2.312	204	0.095	0.132	5yzgY.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:7dgqA5	0.070	0.140	3.266	98	0.035	0.102	7dgqA5.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
19	PDB:2luuA	0.064	0.115	3.881	127	0.095	0.213	2luuA.pdb.gz
20	PDB:3jb9U	0.201	0.147	4.111	430	0.053	0.035	3jb9U.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q92956	0.0	577	283	1.000	1.000	TNR14_HUMAN Tumor necrosis factor receptor superfamily member 14 OS=Homo sapiens OX=9606 GN=TNFRSF14 PE=1 SV=3
2	Q71F55	1.01e-69	218	276	0.424	0.435	Q71F55_MOUSE Herpes virus entry mediator OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
3	Q80WM9	1.42e-68	215	275	0.410	0.422	TNR14_MOUSE Tumor necrosis factor receptor superfamily member 14 OS=Mus musculus OX=10090 GN=Tnfrsf14 PE=1 SV=1
4	F1RAS9	1.14e-22	98.6	425	0.194	0.129	F1RAS9_DANRE Tumor necrosis factor receptor superfamily, member 1B OS=Danio rerio OX=7955 GN=tnfrsf1b PE=4 SV=2
5	P27512	7.88e-21	91.7	289	0.201	0.197	TNR5_MOUSE Tumor necrosis factor receptor superfamily member 5 OS=Mus musculus OX=10090 GN=Cd40 PE=1 SV=3
6	A0A8I6AHI1	1.84e-20	91.3	309	0.226	0.207	A0A8I6AHI1_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
7	F6SVZ3	3.31e-20	89.7	269	0.212	0.223	F6SVZ3_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
8	P25942	1.18e-19	88.2	277	0.180	0.184	TNR5_HUMAN Tumor necrosis factor receptor superfamily member 5 OS=Homo sapiens OX=9606 GN=CD40 PE=1 SV=1
9	A0A8I6A4J5	4.88e-19	86.3	260	0.187	0.204	A0A8I6A4J5_RAT Tumor necrosis factor receptor superfamily member 5 OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
10	A0A8I5XVD8	8.45e-19	84.3	204	0.170	0.235	A0A8I5XVD8_RAT CD40 molecule OS=Rattus norvegicus OX=10116 GN=Cd40 PE=4 SV=1
11	B8X730	3.51e-16	79.0	286	0.212	0.210	B8X730_DANRE CD40 molecule, TNF receptor superfamily member 5 OS=Danio rerio OX=7955 GN=si:ch211-231h20.3 PE=2 SV=1
12	P20333	8.40e-16	79.3	461	0.187	0.115	TNR1B_HUMAN Tumor necrosis factor receptor superfamily member 1B OS=Homo sapiens OX=9606 GN=TNFRSF1B PE=1 SV=3
13	O95407	5.43e-15	75.5	300	0.194	0.183	TNF6B_HUMAN Tumor necrosis factor receptor superfamily member 6B OS=Homo sapiens OX=9606 GN=TNFRSF6B PE=1 SV=1
14	P15725	1.95e-14	73.6	271	0.180	0.188	TNR4_RAT Tumor necrosis factor receptor superfamily member 4 OS=Rattus norvegicus OX=10116 GN=Tnfrsf4 PE=2 SV=1
15	P50284	3.26e-13	71.2	415	0.180	0.123	TNR3_MOUSE Tumor necrosis factor receptor superfamily member 3 OS=Mus musculus OX=10090 GN=Ltbr PE=1 SV=1
16	O00300	9.80e-13	69.7	401	0.173	0.122	TR11B_HUMAN Tumor necrosis factor receptor superfamily member 11B OS=Homo sapiens OX=9606 GN=TNFRSF11B PE=1 SV=3
17	P36941	9.99e-13	70.1	435	0.233	0.152	TNR3_HUMAN Tumor necrosis factor receptor superfamily member 3 OS=Homo sapiens OX=9606 GN=LTBR PE=1 SV=1
18	Q8V2D1	1.38e-12	66.6	175	0.117	0.189	Q8V2D1_HCMV UL144 protein OS=Human cytomegalovirus OX=10359 PE=1 SV=1
19	Q80WY6	2.73e-12	68.9	474	0.155	0.093	TNR1B_RAT Tumor necrosis factor receptor superfamily member 1B OS=Rattus norvegicus OX=10116 GN=Tnfrsf1b PE=2 SV=1
20	Q0PKX6	3.71e-12	68.2	436	0.212	0.138	Q0PKX6_DANRE Ovarian TNF receptor OS=Danio rerio OX=7955 GN=otr PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05393 Hum_adeno_E3A	14	17.3	Human adenovirus early E3A glycoprotein
2	PF03707 MHYT	4.5e+02	12.4	Bacterial signalling protein N terminal repeat
3	PF03419 Peptidase_U4	5.3e+02	11.3	Sporulation factor SpoIIGA
4	PF00020 TNFR_c6	7.5e-13	60.0	TNFR/NGFR cysteine-rich region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347948

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000333919	0.999	B- and T-lymphocyte attenuator
2	9606.ENSP00000469049	0.999	Tumor necrosis factor ligand superfamily member 14
3	9606.ENSP00000403495	0.996	Lymphotoxin-alpha
4	9606.ENSP00000235933	0.990	CD160 antigen
5	9606.ENSP00000357103	0.989	Atypical chemokine receptor 1
6	9606.ENSP00000264025	0.982	Nectin-1
7	9606.ENSP00000247668	0.968	TNF receptor-associated factor 2
8	9606.ENSP00000419945	0.942	Syncytin-1
9	9606.ENSP00000261464	0.930	TNF receptor-associated factor 5
10	9606.ENSP00000398698	0.919	Tumor necrosis factor
11	9606.ENSP00000386559	0.877	T-cell surface glycoprotein CD8 alpha chain
12	9606.ENSP00000320084	0.870	CD276 antigen
13	9606.ENSP00000340944	0.851	Tyrosine-protein phosphatase non-receptor type 11
14	9606.ENSP00000252483	0.767	Nectin-2
15	9606.ENSP00000162749	0.743	Tumor necrosis factor receptor superfamily member 1A
16	9606.ENSP00000362994	0.728	TNF receptor-associated factor 1
17	9606.ENSP00000391592	0.728	Tyrosine-protein phosphatase non-receptor type 6
18	9606.ENSP00000011653	0.711	T-cell surface glycoprotein CD4
19	9606.ENSP00000376345	0.701	Growth factor receptor-bound protein 2
20	9606.ENSP00000368538	0.675	Tumor necrosis factor receptor superfamily member 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019955	1.000	cytokine binding
GO:0005035	1.000	death receptor activity
GO:0031625	1.000	ubiquitin protein ligase binding
GO:0005031	0.659	tumor necrosis factor receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0048522	0.993	positive regulation of cellular process
GO:0050896	0.992	response to stimulus
GO:0007154	0.988	cell communication
GO:0023052	0.986	signaling
GO:0051249	0.985	regulation of lymphocyte activation
GO:0048583	0.968	regulation of response to stimulus
GO:0050863	0.964	regulation of T cell activation
GO:1903037	0.963	regulation of leukocyte cell-cell adhesion
GO:0002376	0.958	immune system process
GO:0051716	0.958	cellular response to stimulus
GO:0002684	0.952	positive regulation of immune system process
GO:0007165	0.951	signal transduction
GO:0051240	0.916	positive regulation of multicellular organismal process
GO:0048519	0.914	negative regulation of biological process
GO:0007166	0.838	cell surface receptor signaling pathway
GO:0002696	0.708	positive regulation of leukocyte activation
GO:0006955	0.702	immune response
GO:0050776	0.644	regulation of immune response
GO:0045785	0.556	positive regulation of cell adhesion
GO:0051251	0.547	positive regulation of lymphocyte activation
GO:0019222	0.533	regulation of metabolic process
GO:1903039	0.520	positive regulation of leukocyte cell-cell adhesion
GO:0060255	0.500	regulation of macromolecule metabolic process
GO:0002683	0.498	negative regulation of immune system process
GO:0048523	0.455	negative regulation of cellular process
GO:0050870	0.347	positive regulation of T cell activation
GO:0009893	0.320	positive regulation of metabolic process
GO:0002819	0.300	regulation of adaptive immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.615	organelle
GO:0043227	0.499	membrane-bounded organelle
GO:0009986	0.342	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]