StarFunc result for job id Q92974

User Input

>input (986 residues)
MSRIESLTRARIDRSRELASKTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKSI
TAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTIRERP
SSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLNM
RNRTLSVESLIDEAEVIYSELMSDFEMDEKDFAADSWSLAVDSSFLQQHKKEVMKQQDVI
YELIQTELHHVRTLKIMTRLFRTGMLEELHLEPGVVQGLFPCVDELSDIHTRFLSQLLER
RRQALCPGSTRNFVIHRLGDLLISQFSGPSAEQMCKTYSEFCSRHSKALKLYKELYARDK
RFQQFIRKVTRPAVLKRHGVQECILLVTQRITKYPLLISRILQHSHGIEEERQDLTTALG
LVKELLSNVDEGIYQLEKGARLQEIYNRMDPRAQTPVPGKGPFGREELLRRKLIHDGCLL
WKTATGRFKDVLVLLMTDVLVFLQEKDQKYIFPTLDKPSVVSLQNLIVRDIANQEKGMFL
ISAAPPEMYEVHTASRDDRSTWIRVIQQSVRTCPSREDFPLIETEDEAYLRRIKMELQQK
DRALVELLREKVGLFAEMTHFQAEEDGGSGMALPTLPRGLFRSESLESPRGERLLQDAIR
EVEGLKDLLVGPGVELLLTPREPALPLEPDSGGNTSPGVTANGEARTFNGSIELCRADSD
SSQRDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLCRA
NSRDGEAGRAGAAPVAPEKQATELALLQRQHALLQEELRRCRRLGEERATEAGSLEARLR
ESEQARALLEREAEEARRQLAALGQTEPLPAEAPWARRPVDPRRRSLPAGDALYLSFNPP
QPSRGTDRLDLPVTTRSVHRNFEDRERQELGSPEERLQDSSDPDTGSEEEGSSRLSPPHS
PRDFTRMQDIPEETESRDGEAVASES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F7BYT9	0.481	0.398	0.000	1245	0.967	0.765	F7BYT9.pdb.gz	F7BYT9_MACMU Rho guanine nucleotide exchange factor 2 OS=Macaca mulatta OX=9544 GN=ARHGEF2 PE=4 SV=3
2	AFDB:Q5FVC2	0.563	0.563	0.000	985	0.890	0.891	Q5FVC2.pdb.gz	ARHG2_RAT Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Arhgef2 PE=1 SV=1
3	AFDB:Q8N1W1	0.390	0.235	5.485E-56	1705	0.353	0.204	Q8N1W1.pdb.gz	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
4	AFDB:F6P6M2	0.396	0.233	5.965E-54	1753	0.330	0.185	F6P6M2.pdb.gz	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
5	AFDB:P97433	0.388	0.234	2.761E-53	1693	0.349	0.203	P97433.pdb.gz	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
6	AFDB:M0QZR4	0.347	0.353	4.582E-26	968	0.160	0.163	M0QZR4.pdb.gz	M0QZR4_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=1
7	AFDB:F1R1Q2	0.304	0.263	1.239E-19	1157	0.151	0.129	F1R1Q2.pdb.gz	F1R1Q2_DANRE Pleckstrin homology domain-containing family G member 5 isoform X1 OS=Danio rerio OX=7955 GN=plekhg5a PE=4 SV=2
8	AFDB:Q9NR81	0.263	0.446	2.912E-18	526	0.099	0.186	Q9NR81.pdb.gz	ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=ARHGEF3 PE=1 SV=1
9	AFDB:Q5JSP0	0.181	0.243	5.843E-18	725	0.106	0.145	Q5JSP0.pdb.gz	FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FGD3 PE=1 SV=1
10	AFDB:Q1MT42	0.263	0.457	1.348E-17	506	0.090	0.176	Q1MT42.pdb.gz	Q1MT42_DANRE Rho guanine nucleotide exchange factor 3 OS=Danio rerio OX=7955 GN=si:ch211-258l4.8 PE=4 SV=1
11	PDB:7rx9A	0.172	0.378	4.230E-14	432	0.083	0.190	7rx9A.pdb.gz
12	PDB:4mt6A	0.224	0.470	1.091E-12	389	0.057	0.144	4mt6A.pdb.gz
13	PDB:4gouA	0.166	0.306	1.403E-6	507	0.059	0.114	4gouA.pdb.gz
14	PDB:6u3eA	0.080	0.186	2.318E-4	397	0.048	0.118	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
15	PDB:3ljuX	0.086	0.211	2.428E-4	373	0.019	0.051	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
16	PDB:6bbpA	0.086	0.154	4.651E-4	520	0.051	0.096	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:6hhgA	0.087	0.217	1.233E-3	386	0.013	0.034	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
18	PDB:5yqrA	0.094	0.305	1.485E-3	268	0.027	0.101	5yqrA.pdb.gz
19	PDB:4mk0A	0.086	0.131	2.844E-3	631	0.038	0.059	4mk0A.pdb.gz	Structural and functional analysis of g protein-coupled receptor kinase inhibition by paroxetine and a rationally designed analog.
20	PDB:6s9wA	0.085	0.197	4.524E-3	411	0.013	0.032	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WTD7	0.0	569	1429	0.348	0.240	A0A087WTD7_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=1
2	A8MYJ1	0.0	565	1434	0.344	0.236	A8MYJ1_HUMAN A-kinase anchoring protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=3
3	B2DCZ9	0.0	1871	961	0.932	0.956	ARHG2_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa OX=9823 GN=ARHGEF2 PE=2 SV=1
4	F1RLP5	0.0	1929	987	0.959	0.958	F1RLP5_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa OX=9823 GN=ARHGEF2 PE=4 SV=4
5	F7BYT9	0.0	1939	1245	0.966	0.765	F7BYT9_MACMU Rho guanine nucleotide exchange factor 2 OS=Macaca mulatta OX=9544 GN=ARHGEF2 PE=4 SV=3
6	Q5FVC2	0.0	1777	985	0.891	0.892	ARHG2_RAT Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus OX=10116 GN=Arhgef2 PE=1 SV=1
7	Q60875	0.0	1777	985	0.886	0.887	ARHG2_MOUSE Rho guanine nucleotide exchange factor 2 OS=Mus musculus OX=10090 GN=Arhgef2 PE=1 SV=4
8	Q865S3	0.0	1867	986	0.931	0.931	ARHG2_CANLF Rho guanine nucleotide exchange factor 2 OS=Canis lupus familiaris OX=9615 GN=ARHGEF2 PE=1 SV=1
9	Q92974	0.0	2012	986	1.000	1.000	ARHG2_HUMAN Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2 PE=1 SV=4
10	E9Q394	2.92e-176	571	2776	0.338	0.120	AKP13_MOUSE A-kinase anchor protein 13 OS=Mus musculus OX=10090 GN=Akap13 PE=1 SV=1
11	Q12802	2.02e-174	566	2813	0.348	0.122	AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13 PE=1 SV=2
12	F1M3G7	2.36e-164	537	2760	0.320	0.114	AKP13_RAT A-kinase anchor protein 13 OS=Rattus norvegicus OX=10116 GN=Akap13 PE=1 SV=2
13	P97433	1.76e-144	473	1700	0.337	0.195	ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus OX=10090 GN=Arhgef28 PE=1 SV=2
14	F6P6M2	7.26e-139	458	1753	0.298	0.168	F6P6M2_DANRE Rho guanine nucleotide exchange factor (GEF) 28a OS=Danio rerio OX=7955 GN=arhgef28 PE=4 SV=1
15	Q8N1W1	1.81e-138	456	1705	0.338	0.195	ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens OX=9606 GN=ARHGEF28 PE=1 SV=3
16	A0A590UK10	2.76e-138	444	1089	0.328	0.297	A0A590UK10_HUMAN Rho guanine nucleotide exchange factor 18 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=4 SV=1
17	A0A3B3IPE9	1.32e-136	440	1119	0.298	0.263	A0A3B3IPE9_HUMAN Rho/Rac guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=2
18	A0A087WZG4	1.51e-136	441	1173	0.298	0.251	A0A087WZG4_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=3
19	Q6ZSZ5	9.37e-136	443	1361	0.328	0.237	ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4
20	F1QCK8	1.55e-130	421	1012	0.291	0.284	F1QCK8_DANRE Rho guanine nucleotide exchange factor 18 isoform X2 OS=Danio rerio OX=7955 GN=arhgef18b PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00130 C1_1	0.04	25.1	Phorbol esters/diacylglycerol binding domain (C1 domain)
2	PF03107 C1_2	1	21.0	C1 domain
3	PF00169 PH	0.3	23.0	PH domain
4	PF00628 PHD	9.1e+02	11.2	PHD-finger
5	PF17838 PH_16	2.1e-31	119.8	PH domain
6	PF14446 Prok-RING_1	15	17.0	Prokaryotic RING finger family 1
7	PF00621 RhoGEF	3.3e-25	100.9	RhoGEF domain
8	PF14369 zinc_ribbon_9	4.5e+02	12.5	zinc-ribbon

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354837

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.999	Transforming protein RhoA
2	9606.ENSP00000271636	0.996	Cingulin
3	9606.ENSP00000222823	0.980	Nucleotide-binding oligomerization domain-containing protein 1
4	9606.ENSP00000348461	0.970	Ras-related C3 botulinum toxin substrate 1
5	9606.ENSP00000281282	0.967	Cingulin-like protein 1
6	9606.ENSP00000230449	0.944	Exocyst complex component 2
7	9606.ENSP00000346671	0.939	Tyrosine-protein kinase Fyn
8	9606.ENSP00000381070	0.917	Dual specificity mitogen-activated protein kinase kinase 7
9	9606.ENSP00000378974	0.907	Mitogen-activated protein kinase 8
10	9606.ENSP00000309597	0.906	Mitogen-activated protein kinase kinase kinase 11
11	9606.ENSP00000303634	0.902	Low-density lipoprotein receptor-related protein 8
12	9606.ENSP00000360280	0.901	Disabled homolog 1
13	9606.ENSP00000392423	0.900	Reelin
14	9606.ENSP00000341189	0.870	Focal adhesion kinase 1
15	9606.ENSP00000356056	0.854	Dynein light chain Tctex-type 1
16	9606.ENSP00000220751	0.850	Receptor-interacting serine/threonine-protein kinase 2
17	9606.ENSP00000429900	0.849	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1
18	9606.ENSP00000385751	0.827	Serine/threonine-protein kinase MARK2
19	9606.ENSP00000264071	0.821	Tubulin beta-4A chain
20	9606.ENSP00000301071	0.811	Tubulin alpha-1A chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019899	0.997	enzyme binding
GO:0031267	0.994	small GTPase binding
GO:0030234	0.935	enzyme regulator activity
GO:0030695	0.929	GTPase regulator activity
GO:0140677	0.924	molecular function activator activity
GO:0005085	0.751	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0050896	0.988	response to stimulus
GO:0009966	0.986	regulation of signal transduction
GO:0051056	0.984	regulation of small GTPase mediated signal transduction
GO:0051716	0.982	cellular response to stimulus
GO:0048518	0.976	positive regulation of biological process
GO:0048522	0.963	positive regulation of cellular process
GO:0034612	0.961	response to tumor necrosis factor
GO:0065009	0.956	regulation of molecular function
GO:0010604	0.952	positive regulation of macromolecule metabolic process
GO:0080090	0.950	regulation of primary metabolic process
GO:0051171	0.950	regulation of nitrogen compound metabolic process
GO:0071356	0.939	cellular response to tumor necrosis factor
GO:0048519	0.928	negative regulation of biological process
GO:0051247	0.928	positive regulation of protein metabolic process
GO:0044093	0.922	positive regulation of molecular function
GO:0019221	0.893	cytokine-mediated signaling pathway
GO:0035020	0.873	regulation of Rac protein signal transduction
GO:0051345	0.868	positive regulation of hydrolase activity
GO:0080134	0.835	regulation of response to stress
GO:1902533	0.820	positive regulation of intracellular signal transduction
GO:0043410	0.788	positive regulation of MAPK cascade
GO:0070372	0.762	regulation of ERK1 and ERK2 cascade
GO:0033209	0.738	tumor necrosis factor-mediated signaling pathway
GO:0080135	0.728	regulation of cellular response to stress
GO:1903036	0.707	positive regulation of response to wounding
GO:0045742	0.707	positive regulation of epidermal growth factor receptor signaling pathway
GO:0032874	0.697	positive regulation of stress-activated MAPK cascade
GO:0048523	0.690	negative regulation of cellular process
GO:0070374	0.689	positive regulation of ERK1 and ERK2 cascade
GO:0051057	0.594	positive regulation of small GTPase mediated signal transduction
GO:0071840	0.532	cellular component organization or biogenesis
GO:0016043	0.490	cellular component organization
GO:0032502	0.475	developmental process
GO:0051128	0.435	regulation of cellular component organization
GO:0032501	0.426	multicellular organismal process
GO:0048856	0.425	anatomical structure development
GO:0006996	0.388	organelle organization
GO:0046579	0.365	positive regulation of Ras protein signal transduction
GO:0031323	0.319	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0030054	0.996	cell junction
GO:0005829	0.995	cytosol
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0005886	0.987	plasma membrane
GO:0005856	0.945	cytoskeleton
GO:0043227	0.864	membrane-bounded organelle
GO:0043231	0.719	intracellular membrane-bounded organelle
GO:0042995	0.560	cell projection
GO:0120025	0.544	plasma membrane bounded cell projection
GO:0045202	0.540	synapse
GO:0099080	0.539	supramolecular complex
GO:0031982	0.535	vesicle
GO:0098794	0.456	postsynapse
GO:0070161	0.426	anchoring junction
GO:0015630	0.329	microtubule cytoskeleton
GO:0032991	0.308	protein-containing complex
GO:0098978	0.302	glutamatergic synapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]