StarFunc result for job id Q92985

User Input

>input (503 residues)
MALAPERAAPRVLFGEWLLGEISSGCYEGLQWLDEARTCFRVPWKHFARKDLSEADARIF
KAWAVARGRWPPSSRGGGPPPEAETAERAGWKTNFRCALRSTRRFVMLRDNSGDPADPHK
VYALSRELCWREGPGTDQTEAEAPAAVPPPQGGPPGPFLAHTHAGLQAPGPLPAPAGDKG
DLLLQAVQQSCLADHLLTASWGADPVPTKAPGEGQEGLPLTGACAGGPGLPAGELYGWAV
ETTPSPGPQPAALTTGEAAAPESPHQAEPYLSPSPSACTAVQEPSPGALDVTIMYKGRTV
LQKVVGHPSCTFLYGPPDPAVRATDPQQVAFPSPAELPDQKQLRYTEELLRHVAPGLHLE
LRGPQLWARRMGKCKVYWEVGGPPGSASPSTPACLLPRNCDTPIFDFRVFFQELVEFRAR
QRRGSPRYTIYLGFGQDLSAGRPKEKSLVLVKLEPWLCRVHLEGTQREGVSSLDSSSLSL
CLSSANSLYDDIECFLMELEQPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92985	1.000	1.000	7.971E-94	503	1.000	1.000	Q92985.pdb.gz	IRF7_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=2
2	AFDB:M9RSF4	0.564	0.580	5.161E-81	487	0.930	0.961	M9RSF4.pdb.gz	M9RSF4_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=1
3	AFDB:A0ZVR0	0.465	0.477	1.395E-64	487	0.668	0.690	A0ZVR0.pdb.gz	A0ZVR0_PIG Interferon regulatory factor 7 OS=Sus scrofa OX=9823 GN=IRF7 PE=1 SV=2
4	AFDB:P70434	0.363	0.398	3.986E-60	457	0.624	0.687	P70434.pdb.gz	IRF7_MOUSE Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1
5	AFDB:Q764M6	0.373	0.443	6.978E-29	419	0.262	0.315	Q764M6.pdb.gz	IRF3_PIG Interferon regulatory factor 3 OS=Sus scrofa OX=9823 GN=IRF3 PE=1 SV=1
6	AFDB:Q13568	0.356	0.359	1.880E-28	498	0.268	0.271	Q13568.pdb.gz	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
7	AFDB:Q5XIB0	0.375	0.444	3.368E-28	421	0.250	0.299	Q5XIB0.pdb.gz	Q5XIB0_RAT Interferon regulatory factor 3 OS=Rattus norvegicus OX=10116 GN=Irf3 PE=2 SV=1
8	AFDB:Q14653	0.349	0.406	2.052E-27	427	0.258	0.304	Q14653.pdb.gz	IRF3_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
9	AFDB:Q61179	0.281	0.349	5.865E-23	399	0.195	0.246	Q61179.pdb.gz	IRF9_MOUSE Interferon regulatory factor 9 OS=Mus musculus OX=10090 GN=Irf9 PE=1 SV=1
10	AFDB:M0QZB7	0.290	0.353	3.181E-22	408	0.213	0.262	M0QZB7.pdb.gz	M0QZB7_HUMAN Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1
11	PDB:6vlsD	0.047	0.030	6.100E-1	963	0.020	0.010	6vlsD.pdb.gz
12	PDB:7ea3J	0.087	0.054	6.466E-1	883	0.034	0.019	7ea3J.pdb.gz
13	PDB:2gjeD	0.075	0.155	6.855E-1	147	0.042	0.143	2gjeD.pdb.gz	Crystal Structures of T. brucei MRP1/MRP2 Guide-RNA Binding Complex Reveal RNA Matchmaking Mechanism.
14	PDB:6z4eA	0.077	0.157	6.855E-1	207	0.018	0.043	6z4eA.pdb.gz
15	PDB:7ttlC	0.077	0.064	7.266E-1	617	0.014	0.011	7ttlC.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
16	PDB:3t6qC	0.068	0.172	7.702E-1	139	0.014	0.050	3t6qC.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
17	PDB:6zxdk	0.086	0.096	8.655E-1	430	0.046	0.053	6zxdk.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
18	PDB:7u05A	0.088	0.045	8.655E-1	1114	0.032	0.014	7u05A.pdb.gz
19	PDB:4gojC	0.098	0.209	9.725E-1	161	0.034	0.106	4gojC.pdb.gz	Structural basis for Arl3-specific release of myristoylated ciliary cargo from UNC119.
20	PDB:7ttjA	0.078	0.063	1.031	643	0.012	0.009	7ttjA.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0ZVR0	0.0	577	487	0.674	0.696	A0ZVR0_PIG Interferon regulatory factor 7 OS=Sus scrofa OX=9823 GN=IRF7 PE=1 SV=2
2	M9RSF4	0.0	928	487	0.930	0.961	M9RSF4_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=1
3	P70434	0.0	543	457	0.616	0.678	IRF7_MOUSE Interferon regulatory factor 7 OS=Mus musculus OX=10090 GN=Irf7 PE=1 SV=1
4	Q92985	0.0	1011	503	1.000	1.000	IRF7_HUMAN Interferon regulatory factor 7 OS=Homo sapiens OX=9606 GN=IRF7 PE=1 SV=2
5	Q9HB64	9.01e-72	226	128	0.217	0.852	Q9HB64_HUMAN Interferon regulatory factor-7H (Fragment) OS=Homo sapiens OX=9606 PE=4 SV=1
6	D2SR00	2.07e-61	209	455	0.296	0.327	D2SR00_SALSA Interferon regulatory factor 7B OS=Salmo salar OX=8030 GN=IRF-7B PE=2 SV=1
7	F1QNG2	4.30e-58	200	422	0.288	0.344	F1QNG2_DANRE Interferon regulatory factor 7 OS=Danio rerio OX=7955 GN=wu:fl24c03 PE=4 SV=1
8	B5X2E7	8.10e-46	167	415	0.276	0.335	B5X2E7_SALSA Interferon regulatory factor 7 OS=Salmo salar OX=8030 GN=IRF7 PE=2 SV=1
9	B6CBU8	9.84e-46	167	415	0.276	0.335	B6CBU8_SALSA Interferon regulatory factor 7 OS=Salmo salar OX=8030 PE=2 SV=1
10	Q64287	1.43e-29	122	450	0.250	0.280	IRF4_MOUSE Interferon regulatory factor 4 OS=Mus musculus OX=10090 GN=Irf4 PE=1 SV=1
11	C0HAD6	2.82e-29	122	482	0.258	0.270	C0HAD6_SALSA Interferon regulatory factor 3 OS=Salmo salar OX=8030 GN=IRF3 PE=2 SV=1
12	D2SQZ9	6.71e-29	121	481	0.268	0.281	D2SQZ9_SALSA Interferon regulatory factor 3 OS=Salmo salar OX=8030 GN=IRF-3 PE=2 SV=1
13	Q15306	1.81e-27	117	451	0.249	0.277	IRF4_HUMAN Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4 PE=1 SV=1
14	H0WFC4	2.07e-27	115	377	0.143	0.191	H0WFC4_DANRE Interferon regulatory factor 7 OS=Danio rerio OX=7955 GN=wu:fl24c03 PE=4 SV=1
15	F9UKU0	1.11e-26	114	415	0.157	0.190	F9UKU0_ONCMY Interferon regulatory factor 7 OS=Oncorhynchus mykiss OX=8022 GN=irf-7 PE=2 SV=1
16	F9UKT9	3.93e-25	110	464	0.239	0.259	F9UKT9_ONCMY Interferon regulatory factor 3 OS=Oncorhynchus mykiss OX=8022 GN=irf-3 PE=2 SV=1
17	B5XBN4	4.14e-25	105	237	0.115	0.245	B5XBN4_SALSA Interferon regulatory factor 3 OS=Salmo salar OX=8030 GN=IRF3 PE=2 SV=1
18	P97431	5.23e-22	100	467	0.135	0.146	IRF6_MOUSE Interferon regulatory factor 6 OS=Mus musculus OX=10090 GN=Irf6 PE=1 SV=2
19	Q13568	1.64e-21	99.8	498	0.171	0.173	IRF5_HUMAN Interferon regulatory factor 5 OS=Homo sapiens OX=9606 GN=IRF5 PE=1 SV=2
20	P70671	1.88e-21	99.0	419	0.107	0.129	IRF3_MOUSE Interferon regulatory factor 3 OS=Mus musculus OX=10090 GN=Irf3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00605 IRF	5.8e-32	121.4	Interferon regulatory factor transcription factor
2	PF10401 IRF-3	1.8e-38	143.7	Interferon-regulatory factor 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000380697

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
2	9606.ENSP00000401399	0.998	Myeloid differentiation primary response protein MyD88
3	9606.ENSP00000368699	0.996	Ubiquitin-like protein ISG15
4	9606.ENSP00000371471	0.996	Radical S-adenosyl methionine domain-containing protein 2
5	9606.ENSP00000381601	0.996	Interferon-induced GTP-binding protein Mx1
6	9606.ENSP00000262367	0.995	CREB-binding protein
7	9606.ENSP00000354394	0.995	Signal transducer and activator of transcription 1-alpha/beta
8	9606.ENSP00000360883	0.995	Interferon-induced protein with tetratricopeptide repeats 3
9	9606.ENSP00000257570	0.994	2'-5'-oligoadenylate synthase-like protein
10	9606.ENSP00000359424	0.994	Inhibitor of nuclear factor kappa-B kinase subunit alpha
11	9606.ENSP00000360869	0.993	Interferon-induced protein with tetratricopeptide repeats 1
12	9606.ENSP00000333657	0.991	Interferon-induced GTP-binding protein Mx2
13	9606.ENSP00000342278	0.991	2'-5'-oligoadenylate synthase 2
14	9606.ENSP00000358997	0.991	Interleukin-1 receptor-associated kinase 1
15	9606.ENSP00000315768	0.990	Signal transducer and activator of transcription 2
16	9606.ENSP00000388001	0.990	2'-5'-oligoadenylate synthase 1
17	9606.ENSP00000395590	0.988	Interferon-induced 35 kDa protein
18	9606.ENSP00000332973	0.987	Mothers against decapentaplegic homolog 3
19	9606.ENSP00000342513	0.986	Plays a role in apoptosis, negatively regulating the intrinsinc apoptotic signaling pathway and TNFSF10-induced apoptosis . However, it has also been shown to have a pro-apoptotic activity . Has an antiviral activity towards hepatitis C virus/HCV by inhibiting the EGFR signaling pathway, which activation is required for entry of the virus into cells . ECO:0000269\|PubMed:17823654, ECO:0000269\|PubMed:25757571,
20	9606.ENSP00000228928	0.985	2'-5'-oligoadenylate synthase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.998	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.959	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.875	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.998	response to stimulus
GO:0009987	0.998	cellular process
GO:0050794	0.998	regulation of cellular process
GO:0010468	0.996	regulation of gene expression
GO:0048518	0.993	positive regulation of biological process
GO:0051716	0.989	cellular response to stimulus
GO:0048522	0.982	positive regulation of cellular process
GO:0006950	0.978	response to stress
GO:0051707	0.978	response to other organism
GO:0048583	0.976	regulation of response to stimulus
GO:0051171	0.973	regulation of nitrogen compound metabolic process
GO:0080090	0.972	regulation of primary metabolic process
GO:0031323	0.969	regulation of cellular metabolic process
GO:0009893	0.968	positive regulation of metabolic process
GO:0051240	0.965	positive regulation of multicellular organismal process
GO:0048584	0.962	positive regulation of response to stimulus
GO:0007154	0.961	cell communication
GO:0050776	0.960	regulation of immune response
GO:0023052	0.959	signaling
GO:0002684	0.959	positive regulation of immune system process
GO:0001817	0.958	regulation of cytokine production
GO:0032101	0.957	regulation of response to external stimulus
GO:0031347	0.957	regulation of defense response
GO:0010628	0.956	positive regulation of gene expression
GO:0002376	0.955	immune system process
GO:0050778	0.952	positive regulation of immune response
GO:0045088	0.951	regulation of innate immune response
GO:0001819	0.950	positive regulation of cytokine production
GO:0048523	0.949	negative regulation of cellular process
GO:0006952	0.947	defense response
GO:0007165	0.945	signal transduction
GO:0002833	0.936	positive regulation of response to biotic stimulus
GO:0019219	0.936	regulation of nucleobase-containing compound metabolic process
GO:0140546	0.935	defense response to symbiont
GO:0032481	0.932	positive regulation of type I interferon production
GO:0031349	0.928	positive regulation of defense response
GO:0031325	0.927	positive regulation of cellular metabolic process
GO:0032103	0.923	positive regulation of response to external stimulus
GO:0051173	0.922	positive regulation of nitrogen compound metabolic process
GO:0045087	0.922	innate immune response
GO:0032728	0.918	positive regulation of interferon-beta production
GO:0009889	0.915	regulation of biosynthetic process
GO:0051607	0.915	defense response to virus
GO:0045089	0.912	positive regulation of innate immune response
GO:0045893	0.905	positive regulation of DNA-templated transcription
GO:0032647	0.892	regulation of interferon-alpha production
GO:0002218	0.891	activation of innate immune response
GO:0002757	0.890	immune response-activating signaling pathway
GO:0002758	0.854	innate immune response-activating signaling pathway
GO:0006357	0.848	regulation of transcription by RNA polymerase II
GO:0002221	0.816	pattern recognition receptor signaling pathway
GO:0030522	0.695	intracellular receptor signaling pathway
GO:0002753	0.684	cytosolic pattern recognition receptor signaling pathway
GO:0045944	0.675	positive regulation of transcription by RNA polymerase II
GO:0010605	0.651	negative regulation of macromolecule metabolic process
GO:0051172	0.549	negative regulation of nitrogen compound metabolic process
GO:0031324	0.503	negative regulation of cellular metabolic process
GO:0042221	0.483	response to chemical
GO:0070887	0.442	cellular response to chemical stimulus
GO:0010033	0.431	response to organic substance
GO:0023051	0.427	regulation of signaling
GO:0010646	0.427	regulation of cell communication
GO:0009966	0.423	regulation of signal transduction
GO:0034097	0.395	response to cytokine
GO:0010941	0.325	regulation of cell death
GO:0071310	0.314	cellular response to organic substance
GO:0043067	0.311	regulation of programmed cell death
GO:0007166	0.308	cell surface receptor signaling pathway
GO:0071345	0.301	cellular response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.999	nucleoplasm
GO:0016020	0.772	membrane
GO:0012505	0.624	endomembrane system
GO:0031982	0.515	vesicle
GO:0031090	0.504	organelle membrane
GO:0010008	0.355	endosome membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]