StarFunc result for job id Q92989

User Input

>input (425 residues)
MGEEANDDKKPTTKFELERETELRFEVEASQSVQLELLTGMAEIFGTELTRNKKFTFDAG
AKVAVFTWHGCSVQLSGRTEVAYVSKDTPMLLYLNTHTALEQMRRQAEKEEERGPRVMVV
GPTDVGKSTVCRLLLNYAVRLGRRPTYVELDVGQGSVSIPGTMGALYIERPADVEEGFSI
QAPLVYHFGSTTPGTNIKLYNKITSRLADVFNQRCEVNRRASVSGCVINTCGWVKGSGYQ
ALVHAASAFEVDVVVVLDQERLYNELKRDLPHFVRTVLLPKSGGVVERSKDFRRECRDER
IREYFYGFRGCFYPHAFNVKFSDVKIYKVGAPTIPDSCLPLGMSQEDNQLKLVPVTPGRD
MVHHLLSVSTAEGTEENLSETSVAGFIVVTSVDLEHQVFTVLSPAPRPLPKNFLLIMDIR
FMDLK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PL17	0.984	0.959	3.416E-92	436	1.000	0.975	E9PL17.pdb.gz	E9PL17_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens OX=9606 GN=CLP1 PE=1 SV=1
2	AFDB:E7F3I6	0.963	0.925	4.277E-80	443	0.791	0.758	E7F3I6.pdb.gz	CLP1_DANRE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Danio rerio OX=7955 GN=clp1 PE=1 SV=1
3	AFDB:Q7K284	0.939	0.943	2.510E-68	423	0.548	0.551	Q7K284.pdb.gz	CLP1_DROME Protein CLP1 homolog OS=Drosophila melanogaster OX=7227 GN=cbc PE=2 SV=1
4	AFDB:P52874	0.958	0.952	1.317E-62	428	0.471	0.467	P52874.pdb.gz	CLP1_CAEEL Protein clpf-1 OS=Caenorhabditis elegans OX=6239 GN=clpf-1 PE=1 SV=2
5	PDB:4ohwA	0.915	0.974	3.558E-59	399	0.447	0.476	4ohwA.pdb.gz	RNA specificity and regulation of catalysis in the eukaryotic polynucleotide kinase clp1.
6	AFDB:Q9SR06	0.956	0.916	4.592E-57	444	0.414	0.396	Q9SR06.pdb.gz	CLP1_ARATH Protein CLP1 homolog OS=Arabidopsis thaliana OX=3702 GN=CLPS3 PE=1 SV=1
7	AFDB:Q10299	0.887	0.829	1.505E-45	456	0.327	0.305	Q10299.pdb.gz	CLP1_SCHPO mRNA cleavage and polyadenylation factor clp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clp1 PE=3 SV=1
8	AFDB:Q08685	0.853	0.816	6.818E-39	445	0.254	0.243	Q08685.pdb.gz	CLP1_YEAST mRNA cleavage and polyadenylation factor CLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLP1 PE=1 SV=1
9	AFDB:Q585W7	0.855	0.859	8.121E-39	423	0.275	0.277	Q585W7.pdb.gz	Q585W7_TRYB2 Pre-mRNA cleavage complex II Clp1-like, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.820 PE=4 SV=1
10	PDB:4c0bB	0.831	0.822	3.609E-38	430	0.240	0.237	4c0bB.pdb.gz	Structural basis for ATP loss by Clp1p in a G135R mutant protein.
11	AFDB:Q57Y15	0.823	0.690	8.819E-32	512	0.261	0.217	Q57Y15.pdb.gz	Q57Y15_TRYB2 Polyribonucleotide 5'-hydroxyl-kinase Clp1 P-loop domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.420 PE=4 SV=1
12	AFDB:Q582U0	0.853	0.824	2.305E-30	441	0.214	0.206	Q582U0.pdb.gz	Q582U0_TRYB2 Polyribonucleotide 5'-hydroxyl-kinase Clp1 P-loop domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.650 PE=4 SV=1
13	PDB:2waaA	0.158	0.190	2.024E-3	335	0.087	0.110	2waaA.pdb.gz
14	PDB:2q9cA	0.230	0.308	3.043E-3	304	0.078	0.109	2q9cA.pdb.gz	X-ray Structures of the Signal Recognition Particle Receptor Reveal Targeting Cycle Intermediates.
15	PDB:1uijC	0.130	0.157	3.420E-3	346	0.028	0.035	1uijC.pdb.gz
16	PDB:1ipkC	0.112	0.124	6.881E-3	379	0.024	0.026	1ipkC.pdb.gz
17	PDB:2vqaA	0.148	0.174	8.688E-3	356	0.031	0.037	2vqaA.pdb.gz	Protein-Folding Location Can Regulate Manganese-Binding Versus Copper- or Zinc-Binding.
18	PDB:2cdnA	0.170	0.325	9.762E-3	186	0.080	0.183	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
19	PDB:1lr5D	0.075	0.160	1.556E-2	160	0.031	0.081	1lr5D.pdb.gz	Crystal structure of auxin-binding protein 1 in complex with auxin.
20	PDB:2awnB	0.162	0.178	1.748E-2	374	0.132	0.150	2awnB.pdb.gz	ATP hydrolysis is required to reset the ATP-binding cassette dimer into the resting-state conformation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7F3I6	0.0	709	443	0.788	0.756	CLP1_DANRE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Danio rerio OX=7955 GN=clp1 PE=1 SV=1
2	E9PL17	0.0	880	436	1.000	0.975	E9PL17_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens OX=9606 GN=CLP1 PE=1 SV=1
3	Q92989	0.0	879	425	1.000	1.000	CLP1_HUMAN Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Homo sapiens OX=9606 GN=CLP1 PE=1 SV=1
4	Q99LI9	0.0	869	425	0.986	0.986	CLP1_MOUSE Polyribonucleotide 5'-hydroxyl-kinase Clp1 OS=Mus musculus OX=10090 GN=Clp1 PE=1 SV=1
5	Q7K284	9.08e-176	499	423	0.548	0.551	CLP1_DROME Protein CLP1 homolog OS=Drosophila melanogaster OX=7227 GN=cbc PE=2 SV=1
6	P52874	3.27e-144	419	428	0.471	0.467	CLP1_CAEEL Protein clpf-1 OS=Caenorhabditis elegans OX=6239 GN=clpf-1 PE=1 SV=2
7	Q9SR06	5.94e-112	337	444	0.412	0.394	CLP1_ARATH Protein CLP1 homolog OS=Arabidopsis thaliana OX=3702 GN=CLPS3 PE=1 SV=1
8	Q10299	5.12e-64	214	456	0.329	0.307	CLP1_SCHPO mRNA cleavage and polyadenylation factor clp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clp1 PE=3 SV=1
9	Q08685	9.63e-32	127	445	0.252	0.240	CLP1_YEAST mRNA cleavage and polyadenylation factor CLP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLP1 PE=1 SV=1
10	Q585W7	1.36e-30	124	423	0.275	0.277	Q585W7_TRYB2 Pre-mRNA cleavage complex II Clp1-like, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4F7.820 PE=4 SV=1
11	Q582U0	1.13e-12	71.6	441	0.132	0.127	Q582U0_TRYB2 Polyribonucleotide 5'-hydroxyl-kinase Clp1 P-loop domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.48O8.650 PE=4 SV=1
12	Q57Y15	1.96e-10	64.7	512	0.134	0.111	Q57Y15_TRYB2 Polyribonucleotide 5'-hydroxyl-kinase Clp1 P-loop domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.420 PE=4 SV=1
13	Q9UU96	1.15e-08	59.7	736	0.108	0.062	GRC3_SCHPO Polynucleotide 5'-hydroxyl-kinase grc3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=grc3 PE=1 SV=1
14	Q8VYP6	3.04e-08	57.8	368	0.092	0.106	NOL9_ARATH Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Arabidopsis thaliana OX=3702 GN=At5g11010 PE=1 SV=1
15	Q07845	8.59e-08	56.6	632	0.111	0.074	GRC3_YEAST Polynucleotide 5'-hydroxyl-kinase GRC3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GRC3 PE=1 SV=1
16	Q5SY16	4.56e-07	54.7	702	0.096	0.058	NOL9_HUMAN Polynucleotide 5'-hydroxyl-kinase NOL9 OS=Homo sapiens OX=9606 GN=NOL9 PE=1 SV=1
17	E7F654	7.42e-07	53.9	713	0.104	0.062	E7F654_DANRE Nucleolar protein 9 OS=Danio rerio OX=7955 GN=nol9 PE=1 SV=1
18	Q383V3	7.48e-07	53.5	430	0.240	0.237	Q383V3_TRYB2 Polyribonucleotide 5'-hydroxyl-kinase Clp1 P-loop domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1510 PE=4 SV=1
19	Q57VM9	5.96e-04	44.7	1034	0.085	0.035	Q57VM9_TRYB2 Polyribonucleotide 5'-hydroxyl-kinase Clp1 P-loop domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O4.440 PE=4 SV=1
20	Q38AX7	0.062	38.1	512	0.064	0.053	Q38AX7_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.0540 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	4.7e+02	12.5	AAA ATPase domain
2	PF13238 AAA_18	1.5e+02	14.3	AAA domain
3	PF13401 AAA_22	2.9e+02	13.1	AAA domain
4	PF03029 ATP_bind_1	19	16.5	Conserved hypothetical ATP binding protein
5	PF01656 CbiA	4.1e+02	12.4	CobQ/CobB/MinD/ParA nucleotide binding domain
6	PF06807 Clp1	7.5e-28	108.7	Pre-mRNA cleavage complex II protein Clp1
7	PF16573 CLP1_N	2.7e-30	115.8	N-terminal beta-sandwich domain of polyadenylation factor
8	PF16575 CLP1_P	5.2e-72	253.1	mRNA cleavage and polyadenylation factor CLP1 P-loop
9	PF01926 MMR_HSR1	30	16.1	50S ribosome-binding GTPase
10	PF05621 TniB	99	13.8	Bacterial TniB protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010381109.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010361168.1	0.994	PCF11 cleavage and polyadenylation factor subunit
2	61622.XP_010356649.1	0.988	Cleavage stimulation factor subunit 3
3	61622.XP_010373524.1	0.983	Cleavage and polyadenylation specificity factor subunit 1
4	61622.XP_010377988.1	0.983	Cleavage and polyadenylation specific factor 3
5	61622.XP_010352005.1	0.980	Belongs to the helicase family. Dicer subfamily.
6	61622.XP_010367319.1	0.977	Factor interacting with PAPOLA and CPSF1
7	61622.XP_010383748.1	0.976	Argonaute 2, RISC catalytic component
8	61622.XP_010374072.1	0.975	Cleavage and polyadenylation specificity factor subunit 4 isoform X1
9	61622.XP_010378483.1	0.974	Cleavage stimulation factor subunit 2
10	61622.XP_010379902.1	0.974	Cleavage stimulation factor subunit 2 tau variant
11	61622.XP_010382796.1	0.959	Cleavage and polyadenylation specificity factor subunit 2
12	61622.XP_010350852.1	0.950	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
13	61622.XP_010375596.1	0.942	tRNA-splicing endonuclease subunit Sen2 isoform X1
14	61622.XP_010362822.1	0.941	Belongs to the short-chain dehydrogenases/reductases (SDR) family
15	61622.XP_010364381.1	0.941	Ribonuclease P protein subunit p40 isoform X1
16	61622.XP_010372198.1	0.941	Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DICER1 and TARBP2 are required to process precursor miRNAs (pre-miRNAs) to mature miRNAs and then load them onto AGO2. AGO2 bound to the mature miRNA constitutes the minimal RISC and may subsequently dissociate from DICER1 and TARBP2. May also play a role in the production of short interfering RNAs (siRNAs) from double-stranded RNA (dsRNA) by DICER1
17	61622.XP_010358645.1	0.917	Cleavage and polyadenylation specific factor 4 like
18	61622.XP_010375715.1	0.917	Zinc finger CCCH-type containing 4
19	61622.XP_010384643.1	0.917	Zinc finger CCCH domain-containing protein 8
20	61622.XP_010384655.1	0.917	Zinc finger CCCH-type containing 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.997	heterocyclic compound binding
GO:0097159	0.997	organic cyclic compound binding
GO:0051736	0.996	polyribonucleotide 5'-hydroxyl-kinase activity
GO:0005524	0.992	ATP binding
GO:0003676	0.399	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007417	0.997	central nervous system development
GO:0060322	0.996	head development
GO:0009987	0.964	cellular process
GO:0021549	0.931	cerebellum development
GO:0021695	0.867	cerebellar cortex development
GO:0071704	0.839	organic substance metabolic process
GO:0044238	0.834	primary metabolic process
GO:0044237	0.825	cellular metabolic process
GO:0006807	0.820	nitrogen compound metabolic process
GO:0043170	0.798	macromolecule metabolic process
GO:0016070	0.790	RNA metabolic process
GO:0010467	0.787	gene expression
GO:0006396	0.781	RNA processing
GO:0006397	0.585	mRNA processing
GO:0050789	0.547	regulation of biological process
GO:0019222	0.377	regulation of metabolic process
GO:0034470	0.359	ncRNA processing
GO:0010468	0.351	regulation of gene expression

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:1902494	0.980	catalytic complex
GO:0140535	0.977	intracellular protein-containing complex
GO:1905348	0.941	endonuclease complex
GO:0140513	0.892	nuclear protein-containing complex
GO:1902555	0.871	endoribonuclease complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:54580	1.000	a 5'-end dephospho-ribonucleoside-RNA + ATP = a 5'-end 5'-monophospho-ribonucleoside-RNA + ADP + H(+)
EC:2.7.1.78	1.000	polynucleotide 5'-hydroxyl-kinase.

[back to server]