StarFunc result for job id Q92993

User Input

>input (513 residues)
MAEVGEIIEGCRLPVLRRNQDNEDEWPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTH
ERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTLPIPVQITLRFNLPK
EREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFPQNGAARRAV
AAQPGRKRKSNCLGTDEDSQDSSDGIPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRH
RLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHLTKCDLRHPPGNEIYRKGTIS
FFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKE
STEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQ
TILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLSEDI
VDGHERAMLKRLLRIDSKCLHFTPKDWSKRGKW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R597	0.764	0.764	5.803E-89	513	1.000	1.000	A0A024R597.pdb.gz
2	AFDB:A0A024R5E8	0.750	0.833	9.370E-79	461	0.899	1.000	A0A024R5E8.pdb.gz
3	AFDB:B0R0X6	0.736	0.726	1.728E-74	520	0.799	0.788	B0R0X6.pdb.gz	B0R0X6_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=zgc:92510 PE=1 SV=1
4	AFDB:Q6DHD0	0.726	0.689	3.415E-74	541	0.799	0.758	Q6DHD0.pdb.gz	Q6DHD0_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=kat5a PE=1 SV=1
5	AFDB:Q960X4	0.714	0.678	3.009E-61	541	0.585	0.555	Q960X4.pdb.gz	TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster OX=7227 GN=Tip60 PE=1 SV=1
6	AFDB:Q08649	0.655	0.750	1.029E-45	445	0.398	0.458	Q08649.pdb.gz	ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESA1 PE=1 SV=1
7	AFDB:Q9FLF7	0.639	0.734	9.130E-44	445	0.361	0.416	Q9FLF7.pdb.gz	MYST1_ARATH Histone acetyltransferase of the MYST family 1 OS=Arabidopsis thaliana OX=3702 GN=HAM1 PE=1 SV=1
8	AFDB:Q9LXD7	0.647	0.742	7.049E-43	445	0.374	0.431	Q9LXD7.pdb.gz	MYST2_ARATH Histone acetyltransferase of the MYST family 2 OS=Arabidopsis thaliana OX=3702 GN=HAM2 PE=1 SV=1
9	AFDB:Q9D1P2	0.591	0.659	6.213E-39	458	0.355	0.397	Q9D1P2.pdb.gz	KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus OX=10090 GN=Kat8 PE=1 SV=1
10	AFDB:E7EUP3	0.527	0.634	8.463E-38	425	0.300	0.362	E7EUP3.pdb.gz	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
11	PDB:7cmrA	0.490	0.938	9.037E-36	263	0.294	0.574	7cmrA.pdb.gz	The Crystal Structure of human MYST1 from Biortus.
12	PDB:7vvuP	0.509	0.957	3.131E-33	270	0.310	0.589	7vvuP.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.
13	PDB:1s5kA	0.159	0.452	3.090E-2	153	0.037	0.124	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones
14	PDB:6yugA	0.169	0.498	6.842E-2	143	0.053	0.189	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.
15	PDB:3t90A	0.159	0.438	7.665E-2	147	0.033	0.116	3t90A.pdb.gz
16	PDB:4evyA	0.123	0.373	1.207E-1	147	0.029	0.102	4evyA.pdb.gz	Structural and Biochemical Characterization of Acinetobacter spp. Aminoglycoside Acetyltransferases Highlights Functional and Evolutionary Variation among Antibiotic Resistance Enzymes.
17	PDB:4fx0B	0.124	0.390	1.278E-1	135	0.023	0.089	4fx0B.pdb.gz
18	PDB:1i1dD	0.170	0.481	1.352E-1	161	0.047	0.149	1i1dD.pdb.gz	The crystal structures of Apo and complexed Saccharomyces cerevisiae GNA1 shed light on the catalytic mechanism of an amino-sugar N-acetyltransferase.
19	PDB:2c27A	0.167	0.263	1.431E-1	301	0.039	0.066	2c27A.pdb.gz	The Substrate-Induced Conformational Change of Mycobacterium Tuberculosis Mycothiol Synthase.
20	PDB:2beiB	0.171	0.458	2.012E-1	159	0.051	0.164	2beiB.pdb.gz	Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8C0NLP0	0.0	1051	522	0.998	0.981	A0A8C0NLP0_CANLF Histone acetyltransferase OS=Canis lupus familiaris OX=9615 GN=KAT5 PE=1 SV=1
2	B0R0X6	0.0	815	520	0.801	0.790	B0R0X6_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=zgc:92510 PE=1 SV=1
3	E9PJI1	0.0	627	302	0.589	1.000	E9PJI1_HUMAN Histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT5 PE=1 SV=1
4	E9PRL6	0.0	511	269	0.491	0.937	E9PRL6_HUMAN Histone acetyltransferase (Fragment) OS=Homo sapiens OX=9606 GN=KAT5 PE=1 SV=1
5	Q6DHD0	0.0	803	541	0.801	0.760	Q6DHD0_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=kat5a PE=1 SV=1
6	Q8CHK4	0.0	1058	513	0.998	0.998	KAT5_MOUSE Histone acetyltransferase KAT5 OS=Mus musculus OX=10090 GN=Kat5 PE=1 SV=2
7	Q92993	0.0	1059	513	1.000	1.000	KAT5_HUMAN Histone acetyltransferase KAT5 OS=Homo sapiens OX=9606 GN=KAT5 PE=1 SV=2
8	Q960X4	0.0	585	541	0.600	0.569	TIP60_DROME Histone acetyltransferase Tip60 OS=Drosophila melanogaster OX=7227 GN=Tip60 PE=1 SV=1
9	Q99MK2	0.0	1058	513	0.998	0.998	KAT5_RAT Histone acetyltransferase KAT5 OS=Rattus norvegicus OX=10116 GN=Kat5 PE=1 SV=2
10	Q9TYU5	4.75e-136	403	458	0.396	0.443	TIP60_CAEEL Histone acetyltransferase Tip60 homolog OS=Caenorhabditis elegans OX=6239 GN=mys-1 PE=2 SV=1
11	O94446	9.74e-120	361	463	0.390	0.432	ESA1_SCHPO Histone acetyltransferase mst1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mst1 PE=1 SV=1
12	C8VBH4	7.97e-119	360	508	0.392	0.396	ESA1_EMENI Histone acetyltransferase esa1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=esa1 PE=3 SV=1
13	Q9LXD7	9.58e-113	343	445	0.324	0.373	MYST2_ARATH Histone acetyltransferase of the MYST family 2 OS=Arabidopsis thaliana OX=3702 GN=HAM2 PE=1 SV=1
14	Q9FLF7	5.86e-111	338	445	0.318	0.366	MYST1_ARATH Histone acetyltransferase of the MYST family 1 OS=Arabidopsis thaliana OX=3702 GN=HAM1 PE=1 SV=1
15	Q08649	2.42e-108	332	445	0.331	0.382	ESA1_YEAST Histone acetyltransferase ESA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ESA1 PE=1 SV=1
16	Q9H7Z6	2.00e-105	324	458	0.316	0.354	KAT8_HUMAN Histone acetyltransferase KAT8 OS=Homo sapiens OX=9606 GN=KAT8 PE=1 SV=2
17	Q9D1P2	2.70e-105	324	458	0.316	0.354	KAT8_MOUSE Histone acetyltransferase KAT8 OS=Mus musculus OX=10090 GN=Kat8 PE=1 SV=1
18	Q7SXF3	3.78e-104	322	487	0.288	0.304	Q7SXF3_DANRE Histone acetyltransferase OS=Danio rerio OX=7955 GN=myst1 PE=1 SV=1
19	E7EUP3	9.78e-104	319	425	0.306	0.369	E7EUP3_HUMAN histone acetyltransferase OS=Homo sapiens OX=9606 GN=KAT7 PE=1 SV=1
20	Q5SVQ0	2.68e-103	324	613	0.296	0.248	KAT7_MOUSE Histone acetyltransferase KAT7 OS=Mus musculus OX=10090 GN=Kat7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	42	15.8	Acetyltransferase (GNAT) family
2	PF13508 Acetyltransf_7	3.5	19.3	Acetyltransferase (GNAT) domain
3	PF01853 MOZ_SAS	1e-82	287.7	MOZ/SAS family
4	PF11717 Tudor-knot	2e-15	67.7	RNA binding activity-knot of a chromodomain
5	PF17772 zf-MYST	1e-18	78.0	MYST family zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000003532

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000019457	0.992	Transformation/transcription domain-associated protein
2	9601.ENSPPYP00000020124	0.988	Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and [...]
3	9601.ENSPPYP00000005850	0.986	E1A binding protein p400
4	9601.ENSPPYP00000002555	0.980	Enhancer of polycomb homolog 1 (Drosophila)
5	9601.ENSPPYP00000011437	0.978	RuvB-like helicase
6	9601.ENSPPYP00000004064	0.975	Amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65)
7	9601.ENSPPYP00000007607	0.975	Component of the NuA4 histone acetyltransferase complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA re [...]
8	9601.ENSPPYP00000008923	0.975	Cellular tumor antigen p53
9	9601.ENSPPYP00000015029	0.975	RuvB-like helicase
10	9601.ENSPPYP00000021181	0.972	MYC proto-oncogene, bHLH transcription factor
11	9601.ENSPPYP00000005415	0.969	Belongs to the MDM2/MDM4 family.
12	9601.ENSPPYP00000016016	0.965	Actin-like 6A
13	9601.ENSPPYP00000005420	0.964	YEATS domain containing 4
14	9601.ENSPPYP00000008230	0.961	Snf2-related CREBBP activator protein
15	9601.ENSPPYP00000001660	0.960	DNA methyltransferase 1 associated protein 1
16	9601.ENSPPYP00000016702	0.960	Histone H2A.Z
17	9601.ENSPPYP00000012531	0.957	MRG/MORF4L binding protein
18	9601.ENSPPYP00000017690	0.956	Bromodomain containing 8
19	9601.ENSPPYP00000001838	0.955	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Deacetylates SP proteins, SP1 and SP3, and regulates their function. Component of the BRG1-RB1-HDAC1 complex, which negatively regulates the CREST-mediated transcription in resting neurons. Upon calcium stimulation, HDAC1 is rel [...]
20	9601.ENSPPYP00000004403	0.951	Serine/threonine protein kinase which activates checkpoint signaling upon double strand breaks (DSBs), apoptosis and genotoxic stresses such as ionizing ultraviolet A light (UVA), thereby acting as a DNA damage sensor. Recognizes the substrate consensus sequence [ST]- Q. Phosphorylates 'Ser-139' of histone variant H2AX/H2AFX at double strand breaks (DSBs), thereby regulating DNA damage response mechanism. Also plays a role in pre-B cell allelic exclusion, a process leading to expression of a single immunoglobulin heavy chain allele to enforce clonality and monospecific recognition by t [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	1.000	chromatin binding
GO:0004402	1.000	histone acetyltransferase activity
GO:0003713	0.996	transcription coactivator activity
GO:0010485	0.919	histone H4 acetyltransferase activity
GO:0008134	0.729	transcription factor binding
GO:0140297	0.622	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0060255	0.994	regulation of macromolecule metabolic process
GO:0051171	0.993	regulation of nitrogen compound metabolic process
GO:0009987	0.992	cellular process
GO:0048518	0.991	positive regulation of biological process
GO:0080090	0.989	regulation of primary metabolic process
GO:0031323	0.989	regulation of cellular metabolic process
GO:0050896	0.988	response to stimulus
GO:0071704	0.982	organic substance metabolic process
GO:0048522	0.981	positive regulation of cellular process
GO:0006355	0.981	regulation of DNA-templated transcription
GO:0009893	0.979	positive regulation of metabolic process
GO:0044238	0.967	primary metabolic process
GO:0032502	0.966	developmental process
GO:0043170	0.966	macromolecule metabolic process
GO:0051716	0.965	cellular response to stimulus
GO:0010604	0.964	positive regulation of macromolecule metabolic process
GO:0006807	0.954	nitrogen compound metabolic process
GO:0051173	0.953	positive regulation of nitrogen compound metabolic process
GO:0032501	0.942	multicellular organismal process
GO:1901564	0.942	organonitrogen compound metabolic process
GO:0031325	0.940	positive regulation of cellular metabolic process
GO:0006950	0.930	response to stress
GO:0045935	0.930	positive regulation of nucleobase-containing compound metabolic process
GO:0048856	0.913	anatomical structure development
GO:0031328	0.913	positive regulation of cellular biosynthetic process
GO:0010557	0.905	positive regulation of macromolecule biosynthetic process
GO:0051254	0.905	positive regulation of RNA metabolic process
GO:0006357	0.896	regulation of transcription by RNA polymerase II
GO:0019538	0.873	protein metabolic process
GO:0043412	0.871	macromolecule modification
GO:0045944	0.863	positive regulation of transcription by RNA polymerase II
GO:0033554	0.830	cellular response to stress
GO:0010033	0.825	response to organic substance
GO:0048869	0.791	cellular developmental process
GO:0007275	0.781	multicellular organism development
GO:0036211	0.732	protein modification process
GO:0070887	0.727	cellular response to chemical stimulus
GO:0030154	0.672	cell differentiation
GO:1901700	0.655	response to oxygen-containing compound
GO:0044237	0.572	cellular metabolic process
GO:0048519	0.462	negative regulation of biological process
GO:0048731	0.444	system development
GO:0048523	0.434	negative regulation of cellular process
GO:0048513	0.408	animal organ development
GO:0071840	0.381	cellular component organization or biogenesis
GO:0016043	0.340	cellular component organization
GO:0009892	0.315	negative regulation of metabolic process
GO:0050793	0.306	regulation of developmental process
GO:0051239	0.304	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0005737	0.991	cytoplasm
GO:0032991	0.988	protein-containing complex
GO:0000785	0.986	chromatin
GO:0005829	0.977	cytosol
GO:1990234	0.693	transferase complex
GO:0140535	0.690	intracellular protein-containing complex
GO:0000123	0.513	histone acetyltransferase complex
GO:0035267	0.438	NuA4 histone acetyltransferase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:21992	1.000	acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone]
EC:2.3.1.48	1.000	histone acetyltransferase.

[back to server]