StarFunc result for job id Q92994

User Input

>input (677 residues)
MTGRVCRGCGGTDIELDAARGDAVCTACGSVLEDNIIVSEVQFVESSGGGSSAVGQFVSL
DGAGKTPTLGGGFHVNLGKESRAQTLQNGRRHIHHLGNQLQLNQHCLDTAFNFFKMAVSR
HLTRGRKMAHVIAACLYLVCRTEGTPHMLLDLSDLLQVNVYVLGKTFLLLARELCINAPA
IDPCLYIPRFAHLLEFGEKNHEVSMTALRLLQRMKRDWMHTGRRPSGLCGAALLVAARMH
DFRRTVKEVISVVKVCESTLRKRLTEFEDTPTSQLTIDEFMKIDLEEECDPPSYTAGQRK
LRMKQLEQVLSKKLEEVEGEISSYQDAIEIELENSRPKAKGGLASLAKDGSTEDTASSLC
GEEDTEDEELEAAASHLNKDLYRELLGGAPGSSEAAGSPEWGGRPPALGSLLDPLPTAAS
LGISDSIRECISSQSSDPKDASGDGELDLSGIDDLEIDRYILNESEARVKAELWMRENAE
YLREQREKEARIAKEKELGIYKEHKPKKSCKRREPIQASTAREAIEKMLEQKKISSKINY
SVLRGLSSAGGGSPHREDAQPEHSASARKLSRRRTPASRSGADPVTSVGKRLRPLVSTQP
AKKVATGEALLPSSPTLGAEPARPQAVLVESGPVSYHADEEADEEEPDEEDGEPCVSALQ
MMGSNDYGCDGDEDDGY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q92994	1.000	1.000	2.875E-93	677	1.000	1.000	Q92994.pdb.gz	TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 PE=1 SV=1
2	AFDB:D4A8W8	0.429	0.424	1.262E-69	686	0.826	0.815	D4A8W8.pdb.gz	D4A8W8_RAT B-related factor 1 OS=Rattus norvegicus OX=10116 GN=Brf1 PE=3 SV=1
3	AFDB:Q5TZ89	0.594	0.583	1.646E-66	693	0.674	0.658	Q5TZ89.pdb.gz
4	AFDB:F1R9S3	0.662	0.676	4.792E-66	661	0.647	0.663	F1R9S3.pdb.gz	F1R9S3_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=brf1 PE=3 SV=1
5	AFDB:Q9NB72	0.481	0.492	8.012E-47	662	0.421	0.431	Q9NB72.pdb.gz	Q9NB72_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=2 SV=1
6	AFDB:Q54U85	0.422	0.407	7.286E-32	706	0.279	0.268	Q54U85.pdb.gz	Q54U85_DICDI TATA box-binding protein-associated factor, RNA polymerase III, subunit 2 OS=Dictyostelium discoideum OX=44689 GN=brf1 PE=4 SV=1
7	AFDB:P29056	0.416	0.470	1.485E-31	596	0.269	0.305	P29056.pdb.gz	TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRF1 PE=1 SV=1
8	AFDB:Q387K4	0.337	0.372	9.353E-20	608	0.195	0.217	Q387K4.pdb.gz	Q387K4_TRYB2 Transcription factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0670 PE=4 SV=1
9	PDB:6eu0Z	0.347	0.665	7.931E-16	339	0.202	0.404	6eu0Z.pdb.gz	Structural basis of RNA polymerase III transcription initiation.
10	AFDB:P62915	0.357	0.732	1.438E-13	316	0.096	0.206	P62915.pdb.gz	TF2B_MOUSE Transcription initiation factor IIB OS=Mus musculus OX=10090 GN=Gtf2b PE=1 SV=1
11	AFDB:P29052	0.352	0.726	1.100E-12	315	0.090	0.194	P29052.pdb.gz	TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster OX=7227 GN=TfIIB PE=2 SV=1
12	PDB:5iy7M	0.332	0.692	3.334E-12	310	0.097	0.213	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
13	PDB:5iy6M	0.322	0.794	2.055E-10	260	0.084	0.219	5iy6M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
14	PDB:7zs9M	0.318	0.640	5.981E-10	310	0.089	0.194	7zs9M.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
15	PDB:4v1nM	0.316	0.654	5.332E-9	299	0.084	0.191	4v1nM.pdb.gz	Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.
16	PDB:7ml4M	0.287	0.743	8.319E-8	234	0.078	0.226	7ml4M.pdb.gz	Structural visualization of de novo transcription initiation by Saccharomyces cerevisiae RNA polymerase II.
17	PDB:1zp2A	0.127	0.357	9.317E-5	227	0.053	0.159	1zp2A.pdb.gz
18	PDB:7kpvB	0.124	0.278	1.264E-4	290	0.052	0.121	7kpvB.pdb.gz
19	PDB:1g3nC	0.127	0.346	1.716E-4	233	0.041	0.120	1g3nC.pdb.gz
20	PDB:7b5lY	0.129	0.327	2.577E-4	253	0.046	0.123	7b5lY.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A8W8	0.0	1016	686	0.833	0.822	D4A8W8_RAT B-related factor 1 OS=Rattus norvegicus OX=10116 GN=Brf1 PE=3 SV=1
2	F1R9S3	0.0	820	661	0.645	0.661	F1R9S3_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=brf1 PE=3 SV=1
3	Q6P9Z3	0.0	823	693	0.669	0.654	Q6P9Z3_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=zgc:63497 PE=2 SV=1
4	Q802Z8	0.0	819	661	0.644	0.660	Q802Z8_DANRE B-related factor 1 OS=Danio rerio OX=7955 GN=brf1 PE=2 SV=1
5	Q8CFK2	0.0	1186	676	0.897	0.898	TF3B_MOUSE Transcription factor IIIB 90 kDa subunit OS=Mus musculus OX=10090 GN=Brf1 PE=1 SV=1
6	Q92994	0.0	1384	677	1.000	1.000	TF3B_HUMAN Transcription factor IIIB 90 kDa subunit OS=Homo sapiens OX=9606 GN=BRF1 PE=1 SV=1
7	Q9VEL2	5.79e-149	449	662	0.397	0.406	Q9VEL2_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=1 SV=2
8	Q9NB72	6.95e-149	449	662	0.391	0.400	Q9NB72_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=2 SV=1
9	Q9NG52	7.26e-149	449	662	0.391	0.400	Q9NG52_DROME B-related factor 1 OS=Drosophila melanogaster OX=7227 GN=Brf PE=2 SV=1
10	Q54U85	2.84e-87	290	706	0.204	0.195	Q54U85_DICDI TATA box-binding protein-associated factor, RNA polymerase III, subunit 2 OS=Dictyostelium discoideum OX=44689 GN=brf1 PE=4 SV=1
11	Q9P6R0	7.55e-87	282	492	0.213	0.293	TF3B_SCHPO Transcription factor IIIB 60 kDa subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brf1 PE=1 SV=2
12	P29056	4.65e-81	270	596	0.285	0.324	TF3B_YEAST Transcription factor IIIB 70 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BRF1 PE=1 SV=1
13	F4IW19	4.57e-48	179	557	0.148	0.180	F4IW19_ARATH Cyclin/Brf1-like TBP-binding protein OS=Arabidopsis thaliana OX=3702 GN=BRF1 PE=1 SV=1
14	Q0WVQ3	8.52e-45	171	604	0.140	0.157	Q0WVQ3_ARATH Cyclin/Brf1-like TBP-binding protein OS=Arabidopsis thaliana OX=3702 GN=BRF2 PE=1 SV=1
15	Q387K4	3.07e-35	143	608	0.142	0.158	Q387K4_TRYB2 Transcription factor, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0670 PE=4 SV=1
16	F4IN86	1.08e-31	132	548	0.126	0.155	F4IN86_ARATH Cyclin/Brf1-like TBP-binding protein OS=Arabidopsis thaliana OX=3702 GN=MEE65 PE=4 SV=1
17	Q00403	1.06e-13	74.7	316	0.103	0.222	TF2B_HUMAN Transcription initiation factor IIB OS=Homo sapiens OX=9606 GN=GTF2B PE=1 SV=1
18	P62915	1.80e-13	74.3	316	0.092	0.196	TF2B_MOUSE Transcription initiation factor IIB OS=Mus musculus OX=10090 GN=Gtf2b PE=1 SV=1
19	P29052	8.71e-12	68.9	315	0.090	0.194	TF2B_DROME Transcription initiation factor IIB OS=Drosophila melanogaster OX=7227 GN=TfIIB PE=2 SV=1
20	O13749	3.16e-10	64.7	340	0.095	0.188	TF2B_SCHPO Transcription initiation factor IIB OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sua7 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07741 BRF1	2e-23	94.0	Brf1-like TBP-binding domain
2	PF00134 Cyclin_N	0.00095	30.3	Cyclin, N-terminal domain
3	PF01857 RB_B	54	15.2	Retinoblastoma-associated protein B domain
4	PF00382 TFIIB	1.8e-58	205.9	Transcription factor TFIIB repeat
5	PF08271 TF_Zn_Ribbon	5.5e-11	53.1	TFIIB zinc-binding

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000448323

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351575	0.999	Transcription factor TFIIIB component B'' homolog
2	9606.ENSP00000375942	0.999	TATA-box-binding protein
3	9606.ENSP00000263956	0.998	General transcription factor 3C polypeptide 3
4	9606.ENSP00000348510	0.994	General transcription factor 3C polypeptide 1
5	9606.ENSP00000361180	0.990	General transcription factor 3C polypeptide 5
6	9606.ENSP00000361219	0.980	General transcription factor 3C polypeptide 4
7	9606.ENSP00000366828	0.975	DNA-directed RNA polymerase III subunit RPC6
8	9606.ENSP00000247219	0.955	TATA box-binding protein-like protein 2
9	9606.ENSP00000228347	0.952	DNA-directed RNA polymerase III subunit RPC2
10	9606.ENSP00000361446	0.951	DNA-directed RNA polymerase III subunit RPC1
11	9606.ENSP00000380904	0.937	DNA-directed RNA polymerase III subunit RPC4
12	9606.ENSP00000334564	0.927	DNA-directed RNA polymerase III subunit RPC3
13	9606.ENSP00000299853	0.924	DNA-directed RNA polymerase III subunit RPC5
14	9606.ENSP00000378736	0.924	DNA-directed RNA polymerase III subunit RPC9
15	9606.ENSP00000302478	0.923	DNA-directed RNA polymerases I and III subunit RPAC2
16	9606.ENSP00000347345	0.923	DNA-directed RNA polymerase III subunit RPC8
17	9606.ENSP00000231509	0.900	Glucocorticoid receptor
18	9606.ENSP00000478303	0.891	DNA-directed RNA polymerases I, II, and III subunit RPABC1
19	9606.ENSP00000293860	0.886	DNA-directed RNA polymerase III subunit RPC10
20	9606.ENSP00000342889	0.885	DNA-directed RNA polymerases I, II, and III subunit RPABC4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.955	heterocyclic compound binding
GO:0097159	0.955	organic cyclic compound binding
GO:0003677	0.951	DNA binding
GO:0003690	0.685	double-stranded DNA binding
GO:1990837	0.608	sequence-specific double-stranded DNA binding
GO:0000976	0.507	transcription cis-regulatory region binding
GO:0008134	0.334	transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0071704	0.984	organic substance metabolic process
GO:0044238	0.983	primary metabolic process
GO:0044237	0.983	cellular metabolic process
GO:0006807	0.975	nitrogen compound metabolic process
GO:0043170	0.963	macromolecule metabolic process
GO:0019222	0.950	regulation of metabolic process
GO:0006351	0.939	DNA-templated transcription
GO:0060255	0.938	regulation of macromolecule metabolic process
GO:0010468	0.891	regulation of gene expression
GO:0050794	0.887	regulation of cellular process
GO:0031323	0.876	regulation of cellular metabolic process
GO:0080090	0.871	regulation of primary metabolic process
GO:0051171	0.871	regulation of nitrogen compound metabolic process
GO:0006383	0.843	transcription by RNA polymerase III
GO:0051252	0.837	regulation of RNA metabolic process
GO:1903311	0.718	regulation of mRNA metabolic process
GO:0006352	0.705	DNA-templated transcription initiation
GO:0098781	0.692	ncRNA transcription
GO:0016072	0.610	rRNA metabolic process
GO:0009303	0.540	rRNA transcription
GO:0009894	0.512	regulation of catabolic process
GO:0048518	0.473	positive regulation of biological process
GO:0065008	0.467	regulation of biological quality
GO:0009893	0.442	positive regulation of metabolic process
GO:0061013	0.424	regulation of mRNA catabolic process
GO:0010556	0.420	regulation of macromolecule biosynthetic process
GO:0031326	0.400	regulation of cellular biosynthetic process
GO:0010604	0.398	positive regulation of macromolecule metabolic process
GO:0010608	0.392	post-transcriptional regulation of gene expression
GO:0006355	0.376	regulation of DNA-templated transcription
GO:0048522	0.309	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.966	protein-containing complex
GO:0005667	0.618	transcription regulator complex
GO:0005737	0.382	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]