StarFunc result for job id Q92997

User Input

>input (716 residues)
MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMDDDFGVVKEEI
SDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELPPPMERTGGIGDSRPPSFHPH
AGGGSQENLDNDTETDSLVSAQRERPRRRDGPEHATRLNGTAKGERRREPGGYDSSSTLM
SSELETTSFFDSDEDDSTSRFSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITD
STMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL
QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRSEPIRPIDPAA
WVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTERLDDFHLSIHSDMAAIVKAMA
SPESGLEVRDRMWLKITIPNAFIGSDVVDWLYHNVEGFTDRREARKYASNLLKAGFIRHT
VNKITFSEQCYYIFGDLCGNMANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQY
PPPPHPYNPHPGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG
SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTHPSYGPPGVPP
LYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQSFRMAMGNPSEFFVDVM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D4ADV8	0.482	0.482	0.000	716	0.987	0.987	D4ADV8.pdb.gz	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
2	AFDB:Q6DKE2	0.256	0.256	1.232E-96	717	0.853	0.852	Q6DKE2.pdb.gz	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
3	AFDB:O14640	0.430	0.440	5.010E-81	695	0.658	0.678	O14640.pdb.gz	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
4	AFDB:F1QM97	0.252	0.244	1.660E-80	747	0.684	0.656	F1QM97.pdb.gz
5	AFDB:P51142	0.368	0.362	1.987E-80	736	0.704	0.685	P51142.pdb.gz	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
6	AFDB:B8JMI2	0.439	0.461	2.240E-80	676	0.690	0.731	B8JMI2.pdb.gz	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
7	AFDB:D3ZB71	0.376	0.367	4.329E-80	736	0.718	0.698	D3ZB71.pdb.gz	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
8	AFDB:P54792	0.235	0.247	4.664E-76	670	0.631	0.675	P54792.pdb.gz	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
9	AFDB:H2KZ17	0.171	0.173	2.555E-44	702	0.331	0.338	H2KZ17.pdb.gz	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
10	AFDB:Q6RHR9	0.128	0.067	1.560E-7	1471	0.175	0.085	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
11	PDB:5n7dA	0.117	0.194	2.112E-5	423	0.028	0.047	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
12	PDB:7pc3A	0.116	0.201	2.849E-5	405	0.046	0.081	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
13	PDB:7p73A	0.115	0.193	3.844E-5	420	0.042	0.071	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
14	PDB:7pc5A	0.114	0.199	6.997E-5	405	0.038	0.067	7pc5A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
15	PDB:7qqmA	0.117	0.196	6.997E-5	413	0.036	0.063	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
16	PDB:2xkxA	0.118	0.117	3.744E-4	721	0.043	0.043	2xkxA.pdb.gz
17	PDB:7shfC	0.122	0.213	3.975E-4	400	0.029	0.052	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
18	PDB:7pcbA	0.103	0.170	5.695E-4	415	0.031	0.053	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:4f7zA	0.106	0.081	6.816E-4	946	0.049	0.037	4f7zA.pdb.gz
20	PDB:7rx9A	0.102	0.167	9.196E-4	432	0.031	0.051	7rx9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6GKX7	0.0	1040	727	0.932	0.917	A0A8I6GKX7_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=1
2	B8JMI2	0.0	830	676	0.689	0.729	B8JMI2_DANRE Dishevelled segment polarity protein 3a OS=Danio rerio OX=7955 GN=dvl3 PE=1 SV=1
3	D3ZB71	0.0	790	736	0.689	0.670	D3ZB71_RAT Dishevelled segment polarity protein 2 OS=Rattus norvegicus OX=10116 GN=Dvl2 PE=3 SV=2
4	D4ADV8	0.0	1435	718	0.979	0.976	D4ADV8_RAT Dishevelled segment polarity protein 3 OS=Rattus norvegicus OX=10116 GN=Dvl3 PE=1 SV=3
5	I3L2N2	0.0	779	730	0.691	0.678	I3L2N2_HUMAN Dishevelled segment polarity protein 2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
6	O14640	0.0	742	695	0.647	0.666	DVL1_HUMAN Segment polarity protein dishevelled homolog DVL-1 OS=Homo sapiens OX=9606 GN=DVL1 PE=1 SV=2
7	O14641	0.0	785	736	0.694	0.675	DVL2_HUMAN Segment polarity protein dishevelled homolog DVL-2 OS=Homo sapiens OX=9606 GN=DVL2 PE=1 SV=1
8	P51141	0.0	774	695	0.642	0.662	DVL1_MOUSE Segment polarity protein dishevelled homolog DVL-1 OS=Mus musculus OX=10090 GN=Dvl1 PE=1 SV=2
9	P51142	0.0	787	736	0.694	0.675	DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 OS=Xenopus laevis OX=8355 GN=dvl2 PE=1 SV=1
10	P54792	0.0	721	670	0.613	0.655	DVLP1_HUMAN Putative segment polarity protein dishevelled homolog DVL1P1 OS=Homo sapiens OX=9606 GN=DVL1P1 PE=5 SV=1
11	Q60838	0.0	788	736	0.684	0.666	DVL2_MOUSE Segment polarity protein dishevelled homolog DVL-2 OS=Mus musculus OX=10090 GN=Dvl2 PE=1 SV=2
12	Q61062	0.0	1452	716	0.990	0.990	DVL3_MOUSE Segment polarity protein dishevelled homolog DVL-3 OS=Mus musculus OX=10090 GN=Dvl3 PE=1 SV=2
13	Q6DKE2	0.0	1097	717	0.844	0.842	DVL3_XENLA Segment polarity protein dishevelled homolog DVL-3 OS=Xenopus laevis OX=8355 GN=dvl3 PE=2 SV=1
14	Q803Q5	0.0	818	747	0.682	0.653	Q803Q5_DANRE Dishevelled, dsh homolog 2 (Drosophila) OS=Danio rerio OX=7955 GN=wu:fo71e09 PE=1 SV=1
15	Q92997	0.0	1465	716	1.000	1.000	DVL3_HUMAN Segment polarity protein dishevelled homolog DVL-3 OS=Homo sapiens OX=9606 GN=DVL3 PE=1 SV=2
16	Q9WVB9	0.0	778	695	0.645	0.665	DVL1_RAT Segment polarity protein dishevelled homolog DVL-1 OS=Rattus norvegicus OX=10116 GN=Dvl1 PE=1 SV=3
17	P51140	2.21e-119	373	623	0.300	0.345	DSH_DROME Segment polarity protein dishevelled OS=Drosophila melanogaster OX=7227 GN=dsh PE=1 SV=2
18	B7WN58	1.22e-104	335	636	0.320	0.360	B7WN58_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
19	H2KZ17	3.33e-104	335	702	0.320	0.326	H2KZ17_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=1
20	B1Q240	2.93e-85	290	915	0.240	0.188	B1Q240_CAEEL DiSHevelled related OS=Caenorhabditis elegans OX=6239 GN=dsh-1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00610 DEP	8.5e-15	65.9	Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP)
2	PF02377 Dishevelled	4.8e-65	230.2	Dishevelled specific domain
3	PF00778 DIX	4.5e-26	101.8	DIX domain
4	PF12316 Dsh_C	1.9e-75	265.3	Segment polarity protein dishevelled (Dsh) C terminal
5	PF00595 PDZ	5.6e-15	66.8	PDZ domain
6	PF17820 PDZ_6	2.2	19.6	PDZ domain
7	PF04917 Shufflon_N	82	14.1	Bacterial shufflon protein, N-terminal constant region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000009718

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001653	0.980	Naked cuticle homolog 1 (Drosophila)
2	60711.ENSCSAP00000009022	0.979	Axin 1
3	60711.ENSCSAP00000015467	0.979	VANGL planar cell polarity protein 2
4	60711.ENSCSAP00000008116	0.978	Dishevelled segment polarity protein 2
5	60711.ENSCSAP00000016345	0.975	VANGL planar cell polarity protein 1
6	60711.ENSCSAP00000010463	0.970	Dishevelled associated activator of morphogenesis 1
7	60711.ENSCSAP00000000451	0.965	Axin 2
8	60711.ENSCSAP00000003307	0.960	Prickle planar cell polarity protein 1
9	60711.ENSCSAP00000008099	0.959	Frizzled class receptor 6
10	60711.ENSCSAP00000017322	0.957	Dishevelled segment polarity protein 1
11	60711.ENSCSAP00000003386	0.956	Glycogen synthase kinase 3 beta
12	60711.ENSCSAP00000011042	0.955	APC, WNT signaling pathway regulator
13	60711.ENSCSAP00000018288	0.954	Frizzled class receptor 7
14	60711.ENSCSAP00000008150	0.953	Prickle planar cell polarity protein 2
15	60711.ENSCSAP00000007308	0.951	Dishevelled associated activator of morphogenesis 2
16	60711.ENSCSAP00000002974	0.949	Uncharacterized protein
17	60711.ENSCSAP00000015895	0.949	Casein kinase 1, delta
18	60711.ENSCSAP00000001100	0.948	Casein kinase 2, alpha prime polypeptide
19	60711.ENSCSAP00000006691	0.948	Belongs to the protein kinase superfamily.
20	60711.ENSCSAP00000004889	0.941	Component of the Wnt-Fzd-LRP5-LRP6 complex that triggers beta-catenin signaling through inducing aggregation of receptor-ligand complexes into ribosome-sized signalsomes.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0019899	0.868	enzyme binding
GO:0042802	0.866	identical protein binding
GO:0001664	0.683	G protein-coupled receptor binding
GO:0019900	0.668	kinase binding
GO:0019901	0.646	protein kinase binding
GO:0005109	0.491	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0007165	0.985	signal transduction
GO:0048518	0.981	positive regulation of biological process
GO:0016055	0.972	Wnt signaling pathway
GO:0048522	0.969	positive regulation of cellular process
GO:0022603	0.942	regulation of anatomical structure morphogenesis
GO:0048583	0.877	regulation of response to stimulus
GO:0019222	0.876	regulation of metabolic process
GO:0035567	0.871	non-canonical Wnt signaling pathway
GO:0010604	0.862	positive regulation of macromolecule metabolic process
GO:0048856	0.854	anatomical structure development
GO:0090175	0.851	regulation of establishment of planar polarity
GO:0031399	0.845	regulation of protein modification process
GO:0051173	0.793	positive regulation of nitrogen compound metabolic process
GO:0031323	0.789	regulation of cellular metabolic process
GO:0016043	0.784	cellular component organization
GO:0031325	0.781	positive regulation of cellular metabolic process
GO:0023051	0.774	regulation of signaling
GO:0010646	0.767	regulation of cell communication
GO:0032501	0.737	multicellular organismal process
GO:0051128	0.733	regulation of cellular component organization
GO:0042221	0.679	response to chemical
GO:0051130	0.658	positive regulation of cellular component organization
GO:0065009	0.642	regulation of molecular function
GO:0007275	0.613	multicellular organism development
GO:0009966	0.586	regulation of signal transduction
GO:0051094	0.579	positive regulation of developmental process
GO:0065008	0.571	regulation of biological quality
GO:0060070	0.556	canonical Wnt signaling pathway
GO:0009888	0.546	tissue development
GO:0009653	0.541	anatomical structure morphogenesis
GO:0009889	0.532	regulation of biosynthetic process
GO:0010556	0.523	regulation of macromolecule biosynthetic process
GO:0019219	0.505	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.496	regulation of RNA metabolic process
GO:0031326	0.495	regulation of cellular biosynthetic process
GO:0048731	0.484	system development
GO:0010468	0.473	regulation of gene expression
GO:0031346	0.438	positive regulation of cell projection organization
GO:0051174	0.408	regulation of phosphorus metabolic process
GO:0019220	0.396	regulation of phosphate metabolic process
GO:0006355	0.396	regulation of DNA-templated transcription
GO:0042325	0.394	regulation of phosphorylation
GO:0051247	0.381	positive regulation of protein metabolic process
GO:0001932	0.362	regulation of protein phosphorylation
GO:0060429	0.323	epithelium development
GO:0022604	0.317	regulation of cell morphogenesis
GO:0048584	0.316	positive regulation of response to stimulus
GO:0048519	0.302	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.997	cytosol
GO:0032991	0.990	protein-containing complex
GO:0043228	0.985	non-membrane-bounded organelle
GO:0043232	0.966	intracellular non-membrane-bounded organelle
GO:0071944	0.943	cell periphery
GO:0043227	0.930	membrane-bounded organelle
GO:0005886	0.927	plasma membrane
GO:0043231	0.900	intracellular membrane-bounded organelle
GO:0031982	0.703	vesicle
GO:0005634	0.663	nucleus
GO:0005856	0.575	cytoskeleton
GO:0070013	0.552	intracellular organelle lumen
GO:0031981	0.487	nuclear lumen
GO:0005654	0.471	nucleoplasm
GO:0015630	0.413	microtubule cytoskeleton
GO:0097708	0.347	intracellular vesicle
GO:0031410	0.339	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]