StarFunc result for job id Q93008

User Input

>input (2554 residues)
MTATTRGSPVGGNDNQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNP
HCKFHIYNGTRPCESVSSSVQLPEDELFARSPDPRSPKGWLVDLLNKFGTLNGFQILHDR
FINGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDEELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDLALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLATYMESMRLYARDHEDYDPQTVRLGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ESNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
SNDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSV
NCARQEAVRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHLSFVVRFPNQGRQVD
DLEVWSHTNDTIGSVRRCILNRIKANVAHTKIELFVGGELIDPADDRKLIGQLNLKDKSL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSLHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDSTTIEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPAGAPLADDSSDFQFHFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAIGYGHVRAVAEACQPGVEGVNPMTQINQVTHDQAVVLQS
ALQSIPNPSSECMLRNVSVRLAQQISDEASRYMPDICVIRAIQKIIWASGCGSLQLVFSP
NEEITKIYEKTNAGNEPDLEDEQVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKTVRQVAQEQFFLMCTRCCMGHRPLLFFITLLFTVLGSTARERAKHSGDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDDVKRTGETGIEETILEGHLGVTKELLAF
QTSEKKFHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCGSPPTINA
GFELLVALAVGCVRNLKQIVDSLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPSIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PQQFEDKPALSKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDNVNPESQLIQQSEQSESETAGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGERNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTIDQDDELIRYISELAITTRPHQ
IIMPSAIERSVRKQNVQFMHNRMQYSMEYFQFMKKLLTCNGVYLNPPPGQDHLLPEAEEI
TMISIQLAARFLFTTGFHTKKVVRGSASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRF
SEYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAV
LNLLRREVSEHGRHLQQYFNLFVMYANLGVAEKTQLLKLSVPATFMLVSLDEGPGPPIKY
QYAELGKLYSVVSQLIRCCNVSSRMQSSINGNPPLPNPFGDPNLSQPIMPIQQNVADILF
VRTSYVKKIIEDCSNSEETVKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLL
LQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPV
AYQILQGNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERS
HSARMTLAKACELCPEEEPDDQDAPDEHESPPPEDAPLYPHSPGSQYQQNNHVHGQPYTG
PAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7yxxA	0.549	0.774	0.000	1754	0.684	0.995	7yxxA.pdb.gz
2	AFDB:F1Q6K1	0.624	0.611	0.000	2621	0.296	0.288	F1Q6K1.pdb.gz	F1Q6K1_DANRE Ubiquitin carboxyl-terminal hydrolase 24 isoform X1 OS=Danio rerio OX=7955 GN=usp24 PE=1 SV=2
3	AFDB:P70398	0.946	0.944	0.000	2559	0.983	0.981	P70398.pdb.gz	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
4	AFDB:Q9UPU5	0.667	0.653	0.000	2620	0.303	0.296	Q9UPU5.pdb.gz	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
5	AFDB:Q09879	0.129	0.286	6.716E-19	1108	0.046	0.106	Q09879.pdb.gz	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
6	AFDB:Q22240	0.127	0.237	7.484E-19	1326	0.048	0.092	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
7	AFDB:Q9FPT1	0.132	0.295	8.966E-19	1116	0.045	0.102	Q9FPT1.pdb.gz	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
8	AFDB:Q76LT8	0.127	0.299	1.598E-18	1036	0.054	0.133	Q76LT8.pdb.gz	UBP48_RAT Ubiquitin carboxyl-terminal hydrolase 48 OS=Rattus norvegicus OX=10116 GN=Usp48 PE=1 SV=1
9	AFDB:E7EY58	0.129	0.286	3.669E-18	1092	0.057	0.134	E7EY58.pdb.gz
10	AFDB:Q38F03	0.133	0.243	8.422E-18	1342	0.046	0.087	Q38F03.pdb.gz	Q38F03_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4020 PE=4 SV=1
11	AFDB:Q9VYQ8	0.126	0.274	8.422E-18	1129	0.044	0.100	Q9VYQ8.pdb.gz	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
12	PDB:5cvnB	0.109	0.797	2.961E-14	321	0.034	0.274	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:3mhsA	0.104	0.542	3.547E-14	455	0.036	0.200	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
14	PDB:5k16B	0.105	0.718	2.009E-13	328	0.036	0.284	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:7w3ax	0.107	0.514	5.728E-13	494	0.032	0.166	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
16	PDB:7qo48	0.113	0.698	1.906E-11	372	0.031	0.215	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.
17	PDB:5gjqx	0.109	0.681	2.124E-11	355	0.032	0.234	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
18	PDB:4fjcE	0.096	0.503	6.055E-11	434	0.034	0.200	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
19	PDB:7ay1D	0.110	0.757	8.382E-11	341	0.031	0.235	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
20	PDB:4wa6D	0.091	0.502	8.690E-11	415	0.031	0.193	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q6K1	0.0	957	2621	0.306	0.298	F1Q6K1_DANRE Ubiquitin carboxyl-terminal hydrolase 24 isoform X1 OS=Danio rerio OX=7955 GN=usp24 PE=1 SV=2
2	O00507	0.0	4890	2555	0.917	0.916	USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens OX=9606 GN=USP9Y PE=2 SV=2
3	P55824	0.0	2294	2778	0.487	0.447	FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster OX=7227 GN=faf PE=1 SV=2
4	P70398	0.0	5263	2559	0.984	0.982	USP9X_MOUSE Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Mus musculus OX=10090 GN=Usp9x PE=1 SV=2
5	Q93008	0.0	5330	2554	1.000	1.000	USP9X_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=4
6	Q9UPU5	0.0	970	2620	0.314	0.306	UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3
7	Q70CQ2	1.44e-70	268	3546	0.098	0.071	UBP34_HUMAN Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34 PE=1 SV=2
8	A0A0B4KHF3	2.47e-53	211	3921	0.059	0.039	A0A0B4KHF3_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
9	A0A0B4LIK5	2.47e-53	211	3921	0.059	0.039	A0A0B4LIK5_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
10	A0A0B4KI06	2.51e-53	211	3930	0.059	0.038	A0A0B4KI06_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=1
11	Q8IMW2	2.75e-53	211	3912	0.059	0.039	Q8IMW2_DROME ubiquitinyl hydrolase 1 OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
12	Q9VC56	2.75e-53	211	3912	0.059	0.039	PUF_DROME Ubiquitin carboxyl-terminal hydrolase puf OS=Drosophila melanogaster OX=7227 GN=puf PE=1 SV=2
13	Q09879	1.76e-35	150	1108	0.049	0.114	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
14	Q9UTT1	9.32e-34	145	1129	0.048	0.109	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
15	Q24574	2.20e-33	144	1556	0.050	0.082	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
16	Q9FPT1	6.05e-33	142	1116	0.048	0.110	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
17	Q84WU2	1.37e-32	141	1115	0.048	0.110	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
18	Q86UV5	2.04e-31	137	1035	0.040	0.098	UBP48_HUMAN Ubiquitin carboxyl-terminal hydrolase 48 OS=Homo sapiens OX=9606 GN=USP48 PE=1 SV=1
19	Q9VYQ8	1.87e-30	134	1129	0.043	0.098	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
20	P50101	1.89e-30	134	1230	0.044	0.091	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08349 DUF1722	3.1e+02	13.0	Protein of unknown function (DUF1722)
2	PF12030 DUF3517	8.3e-103	355.8	Domain of unknown function (DUF3517)
3	PF08463 EcoEI_R_C	6.4e+02	11.9	EcoEI R protein C-terminal
4	PF00443 UCH	4.1e-50	182.4	Ubiquitin carboxyl-terminal hydrolase
5	PF13423 UCH_1	1.5e-16	72.5	Ubiquitin carboxyl-terminal hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010107

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000014084	0.835	MCL1, BCL2 family apoptosis regulator
2	60711.ENSCSAP00000012943	0.764	Catenin beta 1
3	60711.ENSCSAP00000001180	0.760	Unkempt family zinc finger
4	60711.ENSCSAP00000007854	0.760	Uncharacterized protein
5	60711.ENSCSAP00000010696	0.733	Ubiquitin specific peptidase 34
6	60711.ENSCSAP00000013684	0.717	Mindbomb E3 ubiquitin protein ligase 1
7	60711.ENSCSAP00000003303	0.716	Thyroid hormone receptor interactor 12
8	60711.ENSCSAP00000014115	0.687	Mothers against decapentaplegic homolog
9	60711.ENSCSAP00000008706	0.677	HECT, UBA and WWE domain containing 1, E3 ubiquitin protein ligase
10	60711.ENSCSAP00000013625	0.671	Ubiquitin carboxyl-terminal esterase L3 (ubiquitin thiolesterase)
11	60711.ENSCSAP00000006145	0.661	Peroxisomal biogenesis factor 5
12	60711.ENSCSAP00000004175	0.643	Epsin 2
13	60711.ENSCSAP00000016309	0.643	Epsin 1
14	60711.ENSCSAP00000005043	0.642	Uncharacterized protein
15	60711.ENSCSAP00000006451	0.641	Ubiquitinyl hydrolase 1
16	60711.ENSCSAP00000009552	0.630	Ubiquitin carboxyl-terminal hydrolase L5
17	60711.ENSCSAP00000009276	0.614	Uncharacterized protein
18	60711.ENSCSAP00000010684	0.599	Seems to be required for maximal rate of protein biosynthesis. Enhances ribosome dissociation into subunits and stabilizes the binding of the initiator Met-tRNA(I) to 40 S ribosomal subunits
19	60711.ENSCSAP00000011440	0.598	Transducin (beta)-like 1X-linked
20	60711.ENSCSAP00000001645	0.593	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0004197	0.999	cysteine-type endopeptidase activity
GO:0019899	0.915	enzyme binding
GO:0044389	0.784	ubiquitin-like protein ligase binding
GO:0031625	0.764	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.990	cellular process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0006807	0.980	nitrogen compound metabolic process
GO:0043170	0.976	macromolecule metabolic process
GO:0006508	0.957	proteolysis
GO:0070647	0.949	protein modification by small protein conjugation or removal
GO:0050896	0.948	response to stimulus
GO:0044237	0.946	cellular metabolic process
GO:0032501	0.943	multicellular organismal process
GO:0032502	0.936	developmental process
GO:0050789	0.917	regulation of biological process
GO:0050794	0.913	regulation of cellular process
GO:0070646	0.911	protein modification by small protein removal
GO:0016579	0.904	protein deubiquitination
GO:0016043	0.868	cellular component organization
GO:0044260	0.864	cellular macromolecule metabolic process
GO:0048856	0.846	anatomical structure development
GO:0006511	0.830	ubiquitin-dependent protein catabolic process
GO:0019222	0.823	regulation of metabolic process
GO:0009653	0.815	anatomical structure morphogenesis
GO:0007275	0.796	multicellular organism development
GO:0060255	0.768	regulation of macromolecule metabolic process
GO:0071495	0.762	cellular response to endogenous stimulus
GO:0080090	0.747	regulation of primary metabolic process
GO:0051171	0.747	regulation of nitrogen compound metabolic process
GO:0048519	0.707	negative regulation of biological process
GO:0048518	0.677	positive regulation of biological process
GO:0048468	0.612	cell development
GO:0048731	0.569	system development
GO:0048699	0.563	generation of neurons
GO:0048522	0.552	positive regulation of cellular process
GO:0120036	0.525	plasma membrane bounded cell projection organization
GO:0030182	0.522	neuron differentiation
GO:0031323	0.509	regulation of cellular metabolic process
GO:0048666	0.493	neuron development
GO:0048523	0.490	negative regulation of cellular process
GO:0051716	0.467	cellular response to stimulus
GO:0048583	0.423	regulation of response to stimulus
GO:0023051	0.406	regulation of signaling
GO:0010646	0.405	regulation of cell communication
GO:0009966	0.401	regulation of signal transduction
GO:0009893	0.388	positive regulation of metabolic process
GO:0010604	0.380	positive regulation of macromolecule metabolic process
GO:0010468	0.376	regulation of gene expression
GO:0019219	0.375	regulation of nucleobase-containing compound metabolic process
GO:0051173	0.374	positive regulation of nitrogen compound metabolic process
GO:0051246	0.327	regulation of protein metabolic process
GO:0009892	0.320	negative regulation of metabolic process
GO:0010605	0.310	negative regulation of macromolecule metabolic process
GO:0007154	0.305	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005829	0.983	cytosol
GO:0005634	0.970	nucleus
GO:0031981	0.949	nuclear lumen
GO:0005654	0.930	nucleoplasm
GO:0016020	0.916	membrane
GO:0032991	0.487	protein-containing complex
GO:0005886	0.371	plasma membrane
GO:0045177	0.345	apical part of cell
GO:0120025	0.309	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.
EC:3.4.22.-	0.999	Cysteine endopeptidases.

[back to server]