StarFunc result for job id Q93009

User Input

>input (1102 residues)
MNHQQQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVALSDGHNTAEEDME
DDTSWRSEATFQFTVERFSRLSESVLSPPCFVRNLPWKIMVMPRFYPDRPHQKSVGFFLQ
CNAESDSTSWSCHAQAVLKIINYRDDEKSFSRRISHLFFHKENDWGFSNFMAWSEVTDPE
KGFIDDDKVTFEVFVQADAPHGVAWDSKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRK
AVYMMPTEGDDSSKSVPLALQRVFYELQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELC
RVLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNI
FESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIK
INDRFEFPEQLPLDEFLQKTDPKDPANYILHAVLVHSGDNHGGHYVVYLNPKGDGKWCKF
DDDVVSRCTKEEAIEHNYGGHDDDLSVRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQL
VERLQEEKRIEAQKRKERQEAHLYMQVQIVAEDQFCGHQGNDMYDEEKVKYTVFKVLKNS
SLAEFVQSLSQTMGFPQDQIRLWPMQARSNGTKRPAMLDNEADGNKTMIELSDNENPWTI
FLETVDPELAASGATLPKFDKDHDVMLFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVM
CDRAGFIQDTSLILYEEVKPNLTERIQDYDVSLDKALDELMDGDIIVFQKDDPENDNSEL
PTAKEYFRDLYHRVDVIFCDKTIPNDPGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFF
KSQGYRDGPGNPLRHNYEGTLRDLLQFFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLN
SQFREEEITLYPDKHGCVRDLLEECKKAVELGEKASGKLRLLEIVSYKIIGVHQEDELLE
CLSPATSRTFRIEEIPLDQVDIDKENEMLVTVAHFHKEVFGTFGIPFLLRIHQGEHFREV
MKRIQSLLDIQEKEFEKFKFAIVMMGRHQYINEDEYEVNLKDFEPQPGNMSHPRPWLGLD
HFNKAPKRSRYTYLEKAIKIHN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QUS9	0.934	0.927	0.000	1110	0.939	0.932	F1QUS9.pdb.gz	F1QUS9_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
2	AFDB:Q09879	0.621	0.618	0.000	1108	0.312	0.310	Q09879.pdb.gz	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
3	AFDB:Q7JKC3	0.563	0.551	0.000	1135	0.338	0.329	Q7JKC3.pdb.gz	UBP7_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=3 SV=1
4	AFDB:Q9FPT1	0.668	0.661	0.000	1116	0.360	0.356	Q9FPT1.pdb.gz	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
5	AFDB:Q9UTT1	0.501	0.493	0.000	1129	0.331	0.323	Q9UTT1.pdb.gz	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
6	AFDB:Q9VYQ8	0.879	0.859	0.000	1129	0.490	0.478	Q9VYQ8.pdb.gz	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
7	AFDB:P50101	0.600	0.551	2.464E-96	1230	0.303	0.272	P50101.pdb.gz	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
8	AFDB:Q38F03	0.349	0.305	1.400E-60	1342	0.208	0.171	Q38F03.pdb.gz	Q38F03_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4020 PE=4 SV=1
9	AFDB:Q8BY87	0.437	0.366	1.405E-56	1376	0.194	0.156	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
10	AFDB:Q22240	0.494	0.423	9.415E-50	1326	0.178	0.148	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
11	PDB:7yxxA	0.268	0.172	2.504E-25	1754	0.093	0.058	7yxxA.pdb.gz
12	PDB:5cvnB	0.253	0.823	2.946E-25	321	0.081	0.277	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
13	PDB:3mhsA	0.246	0.569	1.309E-23	455	0.075	0.182	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
14	PDB:5k16B	0.245	0.763	3.289E-23	328	0.081	0.271	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
15	PDB:8a9kD	0.230	0.834	1.543E-21	285	0.076	0.295	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
16	PDB:7ay1D	0.242	0.735	6.665E-21	341	0.079	0.255	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
17	PDB:5gjqx	0.238	0.699	1.179E-19	355	0.071	0.220	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
18	PDB:4wa6D	0.213	0.537	1.722E-19	415	0.065	0.173	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
19	PDB:4fjcE	0.221	0.529	2.805E-19	434	0.079	0.200	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
20	PDB:7w3ax	0.240	0.517	1.678E-18	494	0.072	0.160	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QUS9	0.0	2150	1110	0.928	0.922	F1QUS9_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
2	G3MU79	0.0	566	1131	0.346	0.337	G3MU79_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
3	G3MU80	0.0	564	1132	0.347	0.337	G3MU80_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
4	G3MU81	0.0	565	1129	0.347	0.338	G3MU81_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
5	G3MU82	0.0	566	1132	0.346	0.337	G3MU82_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
6	G3MU83	0.0	565	1134	0.346	0.336	G3MU83_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
7	I3ISS5	0.0	2154	1103	0.928	0.927	I3ISS5_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
8	O45623	0.0	563	1133	0.347	0.337	O45623_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
9	O45624	0.0	564	1130	0.347	0.338	O45624_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
10	Q4VSI4	0.0	2289	1103	0.991	0.990	UBP7_RAT Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Usp7 PE=1 SV=1
11	Q6A4J8	0.0	2288	1103	0.991	0.990	UBP7_MOUSE Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus OX=10090 GN=Usp7 PE=1 SV=1
12	Q7JKC3	0.0	565	1135	0.346	0.336	UBP7_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=3 SV=1
13	Q84WU2	0.0	592	1115	0.368	0.363	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
14	Q93009	0.0	2308	1102	1.000	1.000	UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2
15	Q9FPT1	0.0	593	1116	0.368	0.364	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
16	Q9UTT1	0.0	576	1129	0.347	0.338	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
17	Q9VYQ8	0.0	1047	1129	0.490	0.478	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
18	Q09879	4.40e-170	532	1108	0.325	0.323	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
19	P50101	5.52e-143	463	1230	0.317	0.284	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
20	Q38F03	1.93e-52	203	1342	0.151	0.124	Q38F03_TRYB2 Ubiquitin carboxyl-terminal hydrolase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4020 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00917 MATH	1.6e-12	58.9	MATH domain
2	PF15499 Peptidase_C98	1.5e+02	13.3	Ubiquitin-specific peptidase-like, SUMO isopeptidase
3	PF00443 UCH	1.3e-49	180.8	Ubiquitin carboxyl-terminal hydrolase
4	PF13423 UCH_1	1.1e-07	43.4	Ubiquitin carboxyl-terminal hydrolase
5	PF14533 USP7_C2	2.5e-57	205.5	Ubiquitin-specific protease C-terminal
6	PF12436 USP7_ICP0_bdg	1.5e-72	255.4	ICP0-binding domain of Ubiquitin-specific protease 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000343535

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000258149	0.999	E3 ubiquitin-protein ligase Mdm2
2	9606.ENSP00000269305	0.999	Cellular tumor antigen p53
3	9606.ENSP00000352516	0.999	DNA (cytosine-5)-methyltransferase 1
4	9606.ENSP00000356150	0.999	Protein Mdm4
5	9606.ENSP00000363668	0.999	Death domain-associated protein 6
6	9606.ENSP00000374501	0.999	UV-stimulated scaffold protein A
7	9606.ENSP00000419851	0.999	GMP synthase [glutamine-hydrolyzing]
8	9606.ENSP00000479617	0.999	E3 ubiquitin-protein ligase UHRF1
9	9606.ENSP00000441543	0.995	Polyubiquitin-C
10	9606.ENSP00000299563	0.985	E3 ubiquitin-protein ligase RNF169
11	9606.ENSP00000304697	0.980	Polyubiquitin-B
12	9606.ENSP00000361021	0.980	Phosphatase and tensin homolog
13	9606.ENSP00000272317	0.979	Ubiquitin-40S ribosomal protein S27a
14	9606.ENSP00000363377	0.978	Forkhead box protein O4
15	9606.ENSP00000366404	0.977	Zinc finger protein RFP
16	9606.ENSP00000251900	0.962	Sex comb on midleg-like protein 2
17	9606.ENSP00000388107	0.957	Ubiquitin-60S ribosomal protein L40
18	9606.ENSP00000218348	0.956	Ubiquitin carboxyl-terminal hydrolase 11
19	9606.ENSP00000342778	0.946	Protein phosphatase, Mg2+/Mn2+ dependent 1G
20	9606.ENSP00000373696	0.936	E3 ubiquitin-protein ligase TRIP12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity
GO:0004175	0.657	endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006807	0.998	nitrogen compound metabolic process
GO:0044238	0.996	primary metabolic process
GO:0065007	0.995	biological regulation
GO:0043412	0.995	macromolecule modification
GO:0031647	0.987	regulation of protein stability
GO:0070647	0.987	protein modification by small protein conjugation or removal
GO:0006508	0.986	proteolysis
GO:0016579	0.981	protein deubiquitination
GO:0050789	0.978	regulation of biological process
GO:0050794	0.910	regulation of cellular process
GO:0009987	0.659	cellular process
GO:0048518	0.594	positive regulation of biological process
GO:0048522	0.506	positive regulation of cellular process
GO:0019222	0.476	regulation of metabolic process
GO:0060255	0.456	regulation of macromolecule metabolic process
GO:0080090	0.453	regulation of primary metabolic process
GO:0051171	0.451	regulation of nitrogen compound metabolic process
GO:0050896	0.424	response to stimulus
GO:0031323	0.370	regulation of cellular metabolic process
GO:0044237	0.361	cellular metabolic process
GO:0048519	0.356	negative regulation of biological process
GO:0051716	0.334	cellular response to stimulus
GO:0048523	0.311	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0032991	0.994	protein-containing complex
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005829	0.982	cytosol
GO:0005694	0.610	chromosome
GO:0016604	0.411	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]