StarFunc result for job id Q93015

User Input

>input (286 residues)
MELILSTSPAELTLDPACQPKLPLDSTCQPEMTFNPGPTELTLDPEHQPEETPAPSLAEL
TLEPVHRRPELLDACADLINDQWPRSRTSRLHSLGQSSDAFPLCLMLLSPHPTLEAAPVV
VGHARLSRVLNQPQSLLVETVVVARALRGRGFGRRLMEGLEVFARARGFRKLHLTTHDQV
HFYTHLGYQLGEPVQGLVFTSRRLPATLLNAFPTAPSPRPPRKAPNLTAQAAPRGPKGPP
LPPPPPLPECLTISPPVPSGPPSKSLLETQYQNVRGRPIFWMEKDI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q93015	0.999	0.999	3.237E-53	286	1.000	1.000	Q93015.pdb.gz	NAA80_HUMAN N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80 PE=1 SV=2
2	AFDB:Q59DX8	0.483	0.760	1.242E-13	178	0.199	0.320	Q59DX8.pdb.gz	NAA80_DROME N-alpha-acetyltransferase 80 OS=Drosophila melanogaster OX=7227 GN=Naa80 PE=1 SV=1
3	AFDB:Q9ZV08	0.379	0.373	4.786E-8	291	0.126	0.124	Q9ZV08.pdb.gz	GNAT4_ARATH GCN5-related N-acetyltransferase 4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GNAT4 PE=1 SV=1
4	AFDB:Q9C7G6	0.411	0.453	1.069E-7	256	0.122	0.137	Q9C7G6.pdb.gz	GNT10_ARATH GCN5-related N-acetyltransferase 10, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GNAT10 PE=1 SV=1
5	AFDB:P10051	0.384	0.580	2.876E-7	185	0.101	0.157	P10051.pdb.gz	AAC6_CITKO Aminoglycoside N(6')-acetyltransferase type 1 OS=Citrobacter koseri OX=545 GN=aacA1 PE=3 SV=1
6	AFDB:Q94AC8	0.401	0.415	3.682E-7	274	0.133	0.139	Q94AC8.pdb.gz	GNAT7_ARATH GCN5-related N-acetyltransferase 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GNAT7 PE=1 SV=1
7	AFDB:P22567	0.342	0.235	4.716E-7	432	0.101	0.067	P22567.pdb.gz	ARGA_PSEAE Amino-acid acetyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=argA PE=1 SV=2
8	PDB:3fb3B	0.397	0.712	7.410E-7	149	0.115	0.221	3fb3B.pdb.gz
9	AFDB:Q9P6R8	0.347	0.197	1.268E-6	533	0.091	0.049	Q9P6R8.pdb.gz	CWC24_SCHPO Pre-mRNA-splicing factor cwf24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cwf24 PE=1 SV=1
10	AFDB:P21340	0.370	0.577	1.728E-6	172	0.073	0.122	P21340.pdb.gz	PAIA_BACSU Spermidine/spermine N(1)-acetyltransferase OS=Bacillus subtilis (strain 168) OX=224308 GN=paiA PE=1 SV=3
11	AFDB:Q8GUT5	0.354	0.352	1.838E-6	288	0.098	0.097	Q8GUT5.pdb.gz	GNAT6_ARATH GCN5-related N-acetyltransferase 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=GNAT6 PE=1 SV=1
12	PDB:2wpwA	0.396	0.348	2.399E-6	328	0.108	0.095	2wpwA.pdb.gz	Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
13	PDB:3owcA	0.325	0.499	3.699E-6	172	0.112	0.186	3owcA.pdb.gz	Crystal structure of GNAT superfamily protein PA2578 from Pseudomonas aeruginosa
14	PDB:5ygeA	0.329	0.527	4.186E-6	169	0.091	0.154	5ygeA.pdb.gz	Crystal structure of l-glutamate N-acetyltransferase ArgA from Mycobacterium tuberculosis
15	PDB:3dr8A	0.372	0.583	6.066E-6	173	0.112	0.185	3dr8A.pdb.gz	Structure of yncA, a putative ACETYLTRANSFERASE from Salmonella typhimurium with its cofactor Acetyl-CoA
16	PDB:5jq4B	0.359	0.658	7.302E-6	146	0.105	0.205	5jq4B.pdb.gz
17	PDB:4ua3B	0.372	0.525	9.352E-6	194	0.087	0.129	4ua3B.pdb.gz	The Molecular Basis for Histone H4- and H2A-Specific Amino-Terminal Acetylation by NatD.
18	PDB:6e1xC	0.389	0.605	9.352E-6	176	0.105	0.170	6e1xC.pdb.gz	Crystal structure of product-bound complex of spermidine/spermine N-acetyltransferase SpeG from Vibrio cholerae.
19	PDB:3fixA	0.354	0.570	9.948E-6	165	0.070	0.121	3fixA.pdb.gz
20	PDB:1s5kA	0.380	0.664	1.274E-5	153	0.091	0.170	1s5kA.pdb.gz	A bacterial acetyltransferase capable of regioselective N-acetylation of antibiotics and histones

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q93015	0.0	568	286	1.000	1.000	NAA80_HUMAN N-alpha-acetyltransferase 80 OS=Homo sapiens OX=9606 GN=NAA80 PE=1 SV=2
2	Q59DX8	1.48e-23	96.7	178	0.182	0.292	NAA80_DROME N-alpha-acetyltransferase 80 OS=Drosophila melanogaster OX=7227 GN=Naa80 PE=1 SV=1
3	P76594	0.004	41.2	886	0.094	0.030	LYSAC_ECOLI Peptidyl-lysine N-acetyltransferase PatZ OS=Escherichia coli (strain K12) OX=83333 GN=patZ PE=1 SV=1
4	Q5HH30	0.020	37.4	144	0.070	0.139	ATSE_STAAC Acetyltransferase SACOL1063 OS=Staphylococcus aureus (strain COL) OX=93062 GN=SACOL1063 PE=1 SV=1
5	Q5U9F2	0.050	36.2	165	0.129	0.224	GNA1_ORYSJ Glucosamine 6-phosphate N-acetyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=GNA1 PE=1 SV=1
6	I6YG32	0.062	35.8	158	0.112	0.203	RIMI_MYCTU N-alpha-acetyltransferase RimI OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=rimI PE=1 SV=1
7	Q50708	0.062	35.8	158	0.112	0.203	Q50708_MYCTO Acetyltransferase, GNAT family OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT3529 PE=4 SV=1
8	Q6Z1Y6	1.7	32.0	200	0.094	0.135	SNAT2_ORYSJ Serotonin N-acetyltransferase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SNAT2 PE=1 SV=1
9	Q9I1K2	2.1	31.6	171	0.077	0.129	ATSE1_PSEAE Acetyltransferase PA2271 OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA2271 PE=4 SV=1
10	Q008X6	2.7	32.3	6872	0.066	0.003	R1AB_WBV24 Replicase polyprotein 1ab OS=White bream virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 GN=rep PE=1 SV=1
11	Q383G8	2.7	30.8	147	0.063	0.122	Q383G8_TRYB2 Glucosamine 6-phosphate N-acetyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.2886 PE=3 SV=1
12	Q008X5	4.1	31.6	4555	0.066	0.004	R1A_WBV24 Replicase polyprotein 1a OS=White bream virus (isolate Blicca bjoerkna L./Germany/DF24/00) OX=766180 GN=1a PE=1 SV=1
13	Q4GYI3	5.3	31.2	912	0.084	0.026	Q4GYI3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3940 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	4.9e-07	41.4	Acetyltransferase (GNAT) family
2	PF13673 Acetyltransf_10	0.026	25.9	Acetyltransferase (GNAT) domain
3	PF13508 Acetyltransf_7	3.1e-05	35.5	Acetyltransferase (GNAT) domain
4	PF14542 Acetyltransf_CG	59	15.2	GCN5-related N-acetyl-transferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000346927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000225655	0.805	Profilin-1
2	9606.ENSP00000349960	0.800	Actin, cytoplasmic 1
3	9606.ENSP00000355645	0.800	Actin, alpha skeletal muscle
4	9606.ENSP00000362123	0.600	Group XIIB secretory phospholipase A2-like protein
5	9606.ENSP00000432279	0.558	Charged multivesicular body protein 1b
6	9606.ENSP00000204517	0.508	Transcription factor AP-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004596	1.000	peptide alpha-N-acetyltransferase activity
GO:0120227	1.000	acyl-CoA binding
GO:1905502	0.993	acetyl-CoA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:1902903	0.991	regulation of supramolecular fiber organization
GO:0032956	0.991	regulation of actin cytoskeleton organization
GO:0090066	0.990	regulation of anatomical structure size
GO:0030036	0.986	actin cytoskeleton organization
GO:0006473	0.979	protein acetylation
GO:0018193	0.978	peptidyl-amino acid modification
GO:0008064	0.977	regulation of actin polymerization or depolymerization
GO:0018200	0.970	peptidyl-glutamic acid modification
GO:0031365	0.917	N-terminal protein amino acid modification
GO:0051604	0.889	protein maturation
GO:0044085	0.352	cellular component biogenesis
GO:0048518	0.349	positive regulation of biological process
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005634	0.977	nucleus
GO:0031974	0.879	membrane-enclosed lumen
GO:0070013	0.778	intracellular organelle lumen
GO:0031981	0.728	nuclear lumen
GO:0005654	0.635	nucleoplasm
GO:0043232	0.604	intracellular non-membrane-bounded organelle
GO:0016020	0.421	membrane
GO:0071944	0.408	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	1.000	Transferring groups other than amino-acyl groups.

[back to server]