StarFunc result for job id Q93033

User Input

>input (1021 residues)
MAGISYVASFFLLLTKLSIGQREVTVQKGPLFRAEGYPVSIGCNVTGHQGPSEQHFQWSV
YLPTNPTQEVQIISTKDAAFSYAVYTQRVRSGDVYVERVQGNSVLLHISKLQMKDAGEYE
CHTPNTDEKYYGSYSAKTNLIVIPDTLSATMSSQTLGKEEGEPLALTCEASKATAQHTHL
SVTWYLTQDGGGSQATEIISLSKDFILVPGPLYTERFAASDVQLNKLGPTTFRLSIERLQ
SSDQGQLFCEATEWIQDPDETWMFITKKQTDQTTLRIQPAVKDFQVNITADSLFAEGKPL
ELVCLVVSSGRDPQLQGIWFFNGTEIAHIDAGGVLGLKNDYKERASQGELQVSKLGPKAF
SLKIFSLGPEDEGAYRCVVAEVMKTRTGSWQVLQRKQSPDSHVHLRKPAARSVVMSTKNK
QQVVWEGETLAFLCKAGGAESPLSVSWWHIPRDQTQPEFVAGMGQDGIVQLGASYGVPSY
HGNTRLEKMDWATFQLEITFTAITDSGTYECRVSEKSRNQARDLSWTQKISVTVKSLESS
LQVSLMSRQPQVMLTNTFDLSCVVRAGYSDLKVPLTVTWQFQPASSHIFHQLIRITHNGT
IEWGNFLSRFQKKTKVSQSLFRSQLLVHDATEEETGVYQCEVEVYDRNSLYNNRPPRASA
ISHPLRIAVTLPESKLKVNSRSQVQELSINSNTDIECSILSRSNGNLQLAIIWYFSPVST
NASWLKILEMDQTNVIKTGDEFHTPQRKQKFHTEKVSQDLFQLHILNVEDSDRGKYHCAV
EEWLLSTNGTWHKLGEKKSGLTELKLKPTGSKVRVSKVYWTENVTEHREVAIRCSLESVG
SSATLYSVMWYWNRENSGSKLLVHLQHDGLLEYGEEGLRRHLHCYRSSSTDFVLKLHQVE
MEDAGMYWCRVAEWQLHGHPSKWINQASDESQRMVLTVLPSEPTLPSRICSSAPLLYFLF
ICPFVLLLLLLISLLCLYWKARKLSTLRSNTRKEKALWVDLKEAGGVTTNRREDEEEDEG
N

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8E0Y8	0.496	0.490	0.000	1033	0.703	0.695	A8E0Y8.pdb.gz	IGSF2_MOUSE Immunoglobulin superfamily member 2 OS=Mus musculus OX=10090 GN=Cd101 PE=2 SV=1
2	AFDB:Q93033	1.000	1.000	0.000	1021	1.000	1.000	Q93033.pdb.gz	IGSF2_HUMAN Immunoglobulin superfamily member 2 OS=Homo sapiens OX=9606 GN=CD101 PE=1 SV=2
3	AFDB:O75054	0.342	0.298	3.483E-104	1194	0.346	0.296	O75054.pdb.gz	IGSF3_HUMAN Immunoglobulin superfamily member 3 OS=Homo sapiens OX=9606 GN=IGSF3 PE=2 SV=3
4	AFDB:Q9P2B2	0.272	0.312	9.355E-67	879	0.210	0.243	Q9P2B2.pdb.gz	FPRP_HUMAN Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2
5	AFDB:Q62786	0.272	0.314	1.048E-65	879	0.216	0.251	Q62786.pdb.gz	FPRP_RAT Prostaglandin F2 receptor negative regulator OS=Rattus norvegicus OX=10116 GN=Ptgfrn PE=1 SV=1
6	AFDB:Q969P0	0.306	0.479	7.528E-51	613	0.176	0.294	Q969P0.pdb.gz	IGSF8_HUMAN Immunoglobulin superfamily member 8 OS=Homo sapiens OX=9606 GN=IGSF8 PE=1 SV=1
7	AFDB:Q8R366	0.300	0.483	1.329E-50	611	0.170	0.285	Q8R366.pdb.gz	IGSF8_MOUSE Immunoglobulin superfamily member 8 OS=Mus musculus OX=10090 GN=Igsf8 PE=1 SV=2
8	AFDB:Q6NZ26	0.277	0.438	7.181E-46	615	0.154	0.255	Q6NZ26.pdb.gz
9	AFDB:Q7ZZ47	0.180	0.251	3.303E-32	670	0.119	0.182	Q7ZZ47.pdb.gz
10	AFDB:F1LTJ5	0.102	0.055	4.603E-32	2449	0.154	0.064	F1LTJ5.pdb.gz	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
11	PDB:1e07A	0.159	0.226	9.705E-27	642	0.124	0.198	1e07A.pdb.gz
12	PDB:5oj2B	0.137	0.175	2.805E-25	692	0.114	0.168	5oj2B.pdb.gz
13	PDB:7sqcO0	0.142	0.132	5.551E-19	1140	0.091	0.082	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:5a42A	0.103	0.077	4.060E-18	1597	0.087	0.056	5a42A.pdb.gz
15	PDB:4lnvA	0.134	0.119	5.002E-17	1276	0.076	0.061	4lnvA.pdb.gz
16	PDB:4rtdA	0.094	0.087	8.423E-17	1122	0.071	0.064	4rtdA.pdb.gz
17	PDB:7nycA	0.120	0.091	9.437E-16	1542	0.089	0.059	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:7q1yA	0.113	0.096	9.437E-16	1374	0.082	0.061	7q1yA.pdb.gz
19	PDB:6h03A	0.118	0.105	1.088E-15	1223	0.089	0.074	6h03A.pdb.gz
20	PDB:7vonA	0.128	0.105	1.254E-15	1399	0.085	0.062	7vonA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8E0Y8	0.0	1477	1033	0.705	0.697	IGSF2_MOUSE Immunoglobulin superfamily member 2 OS=Mus musculus OX=10090 GN=Cd101 PE=2 SV=1
2	O75054	0.0	629	1194	0.357	0.306	IGSF3_HUMAN Immunoglobulin superfamily member 3 OS=Homo sapiens OX=9606 GN=IGSF3 PE=2 SV=3
3	Q93033	0.0	2122	1021	1.000	1.000	IGSF2_HUMAN Immunoglobulin superfamily member 2 OS=Homo sapiens OX=9606 GN=CD101 PE=1 SV=2
4	Q969P0	1.73e-83	285	613	0.183	0.305	IGSF8_HUMAN Immunoglobulin superfamily member 8 OS=Homo sapiens OX=9606 GN=IGSF8 PE=1 SV=1
5	Q8R366	2.89e-80	276	611	0.175	0.293	IGSF8_MOUSE Immunoglobulin superfamily member 8 OS=Mus musculus OX=10090 GN=Igsf8 PE=1 SV=2
6	C9J8Z4	6.72e-66	226	301	0.112	0.379	C9J8Z4_HUMAN Immunoglobulin superfamily member 8 (Fragment) OS=Homo sapiens OX=9606 GN=IGSF8 PE=1 SV=1
7	Q62786	6.16e-63	232	879	0.217	0.253	FPRP_RAT Prostaglandin F2 receptor negative regulator OS=Rattus norvegicus OX=10116 GN=Ptgfrn PE=1 SV=1
8	Q9WV91	1.56e-62	231	879	0.213	0.247	FPRP_MOUSE Prostaglandin F2 receptor negative regulator OS=Mus musculus OX=10090 GN=Ptgfrn PE=1 SV=2
9	Q9P2B2	3.29e-60	224	879	0.204	0.237	FPRP_HUMAN Prostaglandin F2 receptor negative regulator OS=Homo sapiens OX=9606 GN=PTGFRN PE=1 SV=2
10	Q0PMG2	9.90e-07	55.5	956	0.073	0.078	MDGA1_MOUSE MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Mus musculus OX=10090 GN=Mdga1 PE=2 SV=3
11	P85171	1.11e-06	55.5	956	0.073	0.078	MDGA1_RAT MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Rattus norvegicus OX=10116 GN=Mdga1 PE=1 SV=1
12	A0A3B3IU48	2.55e-06	54.3	973	0.072	0.076	A0A3B3IU48_HUMAN MAM domain containing glycosylphosphatidylinositol anchor 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
13	Q8NFP4	2.89e-06	53.9	955	0.072	0.077	MDGA1_HUMAN MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Homo sapiens OX=9606 GN=MDGA1 PE=1 SV=1
14	P98160	4.35e-05	50.4	4391	0.118	0.027	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
15	Q0WYX8	1.07e-04	48.9	949	0.071	0.076	MDGA1_CHICK MAM domain-containing glycosylphosphatidylinositol anchor protein 1 OS=Gallus gallus OX=9031 GN=MDGA1 PE=1 SV=1
16	A0A0B4K7N1	1.45e-04	48.5	986	0.051	0.053	A0A0B4K7N1_DROME Sidestep, isoform C OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1
17	A0A0B4K6K0	1.72e-04	48.1	943	0.051	0.055	A0A0B4K6K0_DROME Sidestep, isoform D OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1
18	Q967X6	1.75e-04	48.1	939	0.051	0.055	Q967X6_DROME Sidestep OS=Drosophila melanogaster OX=7227 GN=side PE=2 SV=1
19	Q9VB35	1.78e-04	48.1	939	0.051	0.055	Q9VB35_DROME Sidestep, isoform A OS=Drosophila melanogaster OX=7227 GN=side PE=1 SV=2
20	B7Z0R1	2.00e-04	47.8	929	0.051	0.056	B7Z0R1_DROME Sidestep, isoform B OS=Drosophila melanogaster OX=7227 GN=side PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05790 C2-set	3.9	19.0	Immunoglobulin C2-set domain
2	PF07679 I-set	3.8e-28	108.7	Immunoglobulin I-set domain
3	PF00047 ig	7.6e-31	117.5	Immunoglobulin domain
4	PF13895 Ig_2	1.2e-19	81.7	Immunoglobulin domain
5	PF13927 Ig_3	1.7e-41	151.9	Immunoglobulin domain
6	PF16680 Ig_4	0.12	24.3	T-cell surface glycoprotein CD3 delta chain
7	PF16681 Ig_5	2.1	20.2	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
8	PF16706 Izumo-Ig	0.00014	33.1	Izumo-like Immunoglobulin domain
9	PF07686 V-set	5.5e-50	179.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358482

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339186	0.906	GRB2-related adapter protein 2
2	9606.ENSP00000046794	0.904	Lymphocyte cytosolic protein 2
3	9606.ENSP00000378845	0.902	Linker for activation of T cells
4	9606.ENSP00000244007	0.900	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
5	9606.ENSP00000271324	0.740	Leukocyte surface antigen CD53
6	9606.ENSP00000359940	0.707	Immunoglobulin superfamily member 1
7	9606.ENSP00000482202	0.669	Phosphatidylinositol-glycan biosynthesis class W protein
8	9606.ENSP00000238875	0.643	Galectin-related protein
9	9606.ENSP00000371958	0.610	CD9 antigen
10	9606.ENSP00000431445	0.603	T-cell surface glycoprotein CD3 gamma chain
11	9606.ENSP00000464893	0.556	RING finger protein unkempt homolog
12	9606.ENSP00000358501	0.536	Lymphocyte function-associated antigen 3
13	9606.ENSP00000263087	0.535	Integrin alpha-E
14	9606.ENSP00000263645	0.518	CD81 antigen

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0023052	0.987	signaling
GO:0007154	0.987	cell communication
GO:0051716	0.987	cellular response to stimulus
GO:0007165	0.965	signal transduction
GO:0007166	0.956	cell surface receptor signaling pathway
GO:0048518	0.538	positive regulation of biological process
GO:0051239	0.405	regulation of multicellular organismal process
GO:0002682	0.388	regulation of immune system process
GO:0048522	0.360	positive regulation of cellular process
GO:0002684	0.308	positive regulation of immune system process
GO:0051240	0.301	positive regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.999	membrane-bounded organelle
GO:0005886	0.999	plasma membrane
GO:0031982	0.993	vesicle
GO:0005576	0.992	extracellular region
GO:0005615	0.976	extracellular space
GO:1903561	0.972	extracellular vesicle
GO:0070062	0.959	extracellular exosome
GO:0043231	0.763	intracellular membrane-bounded organelle
GO:0005737	0.710	cytoplasm
GO:0009986	0.441	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]