StarFunc result for job id Q93034

User Input

>input (780 residues)
MATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPAK
IHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLMG
KQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIGV
RESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLKE
EEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSLM
DKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYVEQLLTLFNRFSKLVKEAFQ
DDPRFLTARDKAYKAVVNDATIFKLELPLKQKGVGLKTQPESKCPELLANYCDMLLRKTP
LSKKLTSEEIEAKLKEVLLVLKYVQNKDVFMRYHKAHLTRRLILDISADSEIEENMVEWL
REVGMPADYVNKLARMFQDIKVSEDLNQAFKEMHKNNKLALPADSVNIKILNAGAWSRSS
EKVFVSLPTELEDLIPEVEEFYKKNHSGRKLHWHHLMSNGIITFKNEVGQYDLEVTTFQL
AVLFAWNQRPREKISFENLKLATELPDAELRRTLWSLVAFPKLKRQVLLYEPQVNSPKDF
TEGTLFSVNQEFSLIKNAKVQKRGKINLIGRLQLTTERMREEENEGIVQLRILRTQEAII
QIMKMRKKISNAQLQTELVEILKNMFLPQKKMIKEQIEWLIEHKYIRRDESDINTFIYMA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q93034	1.000	1.000	0.000	780	1.000	1.000	Q93034.pdb.gz	CUL5_HUMAN Cullin-5 OS=Homo sapiens OX=9606 GN=CUL5 PE=1 SV=4
2	PDB:6v9iC	0.787	0.834	1.757E-81	730	0.935	0.999	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.
3	AFDB:Q9VAQ0	0.927	0.850	1.200E-77	852	0.650	0.595	Q9VAQ0.pdb.gz	Q9VAQ0_DROME Cullin 5 OS=Drosophila melanogaster OX=7227 GN=Cul5 PE=1 SV=1
4	AFDB:O60999	0.791	0.800	3.455E-40	770	0.290	0.294	O60999.pdb.gz	CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum OX=44689 GN=culA PE=1 SV=1
5	AFDB:A0A0A0MTN0	0.847	0.870	7.004E-40	758	0.271	0.278	A0A0A0MTN0.pdb.gz	A0A0A0MTN0_HUMAN Cullin 2 OS=Homo sapiens OX=9606 GN=CUL2 PE=1 SV=1
6	AFDB:Q6NYS3	0.822	0.825	7.302E-40	777	0.295	0.296	Q6NYS3.pdb.gz	Q6NYS3_DANRE Cullin 1a OS=Danio rerio OX=7955 GN=Cul1 PE=1 SV=1
7	AFDB:Q9XZJ3	0.793	0.802	3.543E-39	771	0.285	0.288	Q9XZJ3.pdb.gz	CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum OX=44689 GN=culB PE=2 SV=1
8	AFDB:Q17389	0.817	0.817	4.941E-39	780	0.256	0.256	Q17389.pdb.gz	CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans OX=6239 GN=cul-1 PE=1 SV=1
9	AFDB:Q9V9R2	0.856	0.885	9.609E-39	753	0.263	0.272	Q9V9R2.pdb.gz	Q9V9R2_DROME Cullin 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Cul2 PE=1 SV=3
10	AFDB:Q54XF7	0.814	0.844	6.503E-38	750	0.245	0.255	Q54XF7.pdb.gz	CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum OX=44689 GN=culE PE=3 SV=1
11	AFDB:Q24311	0.812	0.818	2.171E-37	774	0.268	0.270	Q24311.pdb.gz	CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Cul1 PE=1 SV=2
12	PDB:1ldjA	0.782	0.836	1.871E-34	725	0.292	0.314	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
13	PDB:6ttuC	0.737	0.816	2.266E-33	701	0.288	0.321	6ttuC.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
14	PDB:4a0kA	0.601	0.640	4.129E-29	719	0.244	0.264	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
15	PDB:5n4wA	0.750	0.864	3.996E-27	671	0.249	0.289	5n4wA.pdb.gz	Crystal Structure of the Cul2-Rbx1-EloBC-VHL Ubiquitin Ligase Complex.
16	PDB:6r6hO	0.728	0.759	1.699E-23	745	0.273	0.286	6r6hO.pdb.gz	Structural basis of Cullin 2 RING E3 ligase regulation by the COP9 signalosome.
17	PDB:7z8bC	0.509	0.352	2.831E-11	1224	0.156	0.100	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
18	PDB:5khrN	0.350	0.412	4.586E-10	645	0.127	0.153	5khrN.pdb.gz
19	PDB:5lcwN	0.348	0.381	1.098E-9	703	0.126	0.139	5lcwN.pdb.gz	Molecular basis of APC/C regulation by the spindle assembly checkpoint.
20	PDB:6tm5N	0.315	0.355	1.734E-9	676	0.137	0.158	6tm5N.pdb.gz	A unique binding mode of Nek2A to the APC/C allows its ubiquitination during prometaphase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8SYJ7	0.0	910	636	0.564	0.692	Q8SYJ7_DROME RE55959p OS=Drosophila melanogaster OX=7227 GN=Cul5 PE=2 SV=1
2	Q93034	0.0	1610	780	1.000	1.000	CUL5_HUMAN Cullin-5 OS=Homo sapiens OX=9606 GN=CUL5 PE=1 SV=4
3	Q9D5V5	0.0	1590	780	0.985	0.985	CUL5_MOUSE Cullin-5 OS=Mus musculus OX=10090 GN=Cul5 PE=1 SV=3
4	Q9JJ31	0.0	1593	780	0.987	0.987	CUL5_RAT Cullin-5 OS=Rattus norvegicus OX=10116 GN=Cul5 PE=1 SV=3
5	Q9VAQ0	0.0	920	852	0.576	0.527	Q9VAQ0_DROME Cullin 5 OS=Drosophila melanogaster OX=7227 GN=Cul5 PE=1 SV=1
6	Q6NYS3	3.34e-101	332	777	0.315	0.317	Q6NYS3_DANRE Cullin 1a OS=Danio rerio OX=7955 GN=Cul1 PE=1 SV=1
7	O60999	4.66e-100	328	770	0.297	0.301	CUL1_DICDI Cullin-1 OS=Dictyostelium discoideum OX=44689 GN=culA PE=1 SV=1
8	Q802D4	6.09e-100	328	774	0.314	0.317	Q802D4_DANRE Cul1b protein OS=Danio rerio OX=7955 GN=zgc:111899 PE=1 SV=1
9	Q13616	2.47e-99	327	776	0.312	0.313	CUL1_HUMAN Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2
10	Q9WTX6	2.86e-99	326	776	0.312	0.313	CUL1_MOUSE Cullin-1 OS=Mus musculus OX=10090 GN=Cul1 PE=1 SV=1
11	Q9XZJ3	2.79e-97	321	771	0.294	0.297	CUL2_DICDI Cullin-2 OS=Dictyostelium discoideum OX=44689 GN=culB PE=2 SV=1
12	Q24311	2.79e-83	283	774	0.299	0.301	CUL1_DROME Cullin homolog 1 OS=Drosophila melanogaster OX=7227 GN=Cul1 PE=1 SV=2
13	Q17389	2.43e-81	278	780	0.255	0.255	CUL1_CAEEL Cullin-1 OS=Caenorhabditis elegans OX=6239 GN=cul-1 PE=1 SV=1
14	Q9D4H8	9.80e-81	276	745	0.274	0.287	CUL2_MOUSE Cullin-2 OS=Mus musculus OX=10090 GN=Cul2 PE=1 SV=2
15	A0A8I6G8I6	1.07e-80	276	745	0.274	0.287	A0A8I6G8I6_RAT Cullin 2 OS=Rattus norvegicus OX=10116 GN=Cul2 PE=1 SV=1
16	A0A140VKB1	1.56e-78	270	745	0.276	0.289	A0A140VKB1_HUMAN Testis secretory sperm-binding protein Li 238E OS=Homo sapiens OX=9606 PE=2 SV=1
17	Q13617	1.56e-78	270	745	0.276	0.289	CUL2_HUMAN Cullin-2 OS=Homo sapiens OX=9606 GN=CUL2 PE=1 SV=2
18	A0A0A0MTN0	2.26e-78	270	758	0.276	0.284	A0A0A0MTN0_HUMAN Cullin 2 OS=Homo sapiens OX=9606 GN=CUL2 PE=1 SV=1
19	O13790	6.43e-75	260	767	0.265	0.270	CUL1_SCHPO Cullin-1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cul1 PE=1 SV=1
20	Q54XF7	3.02e-73	255	750	0.238	0.248	CUL5_DICDI Cullin-5 OS=Dictyostelium discoideum OX=44689 GN=culE PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00888 Cullin	6.1e-179	608.3	Cullin family
2	PF10557 Cullin_Nedd8	2.6e-14	64.3	Cullin protein neddylation domain
3	PF18082 NAT_N	3.2e+02	13.6	N-acyltransferase N-terminal domain
4	PF14566 PTPlike_phytase	7.7e+02	11.6	Inositol hexakisphosphate

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 89462.XP_006053395.1

Rank	PPI partner	STRING score	Description
1	89462.XP_006059792.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
2	89462.XP_006071327.1	0.999	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
3	89462.XP_006051650.1	0.998	Transcription elongation factor B polypeptide 1-like
4	89462.XP_006078092.1	0.998	RING-box protein 2 isoform X1
5	89462.XP_006054260.1	0.997	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 30 samples with support for all annotated introns
6	89462.XP_006064552.1	0.994	Suppressor of cytokine signaling 2 isoform X1
7	89462.XP_006053387.1	0.991	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 28 samples with support for all annotated introns
8	89462.XP_006060798.1	0.988	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
9	89462.XP_006043343.1	0.987	NEDD8
10	89462.XP_006069576.1	0.987	NEDD8-like
11	89462.XP_006064171.1	0.986	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments
12	89462.XP_006072137.1	0.984	Core-binding factor subunit beta isoform X1
13	89462.XP_006043857.1	0.971	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 12 samples with support for all annotated introns
14	89462.XP_006078108.1	0.969	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 8 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns
15	89462.XP_006053538.1	0.968	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 12 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 29 samples with support for all annotated introns
16	89462.XP_006076750.1	0.968	SPRY domain-containing SOCS box protein 1
17	89462.XP_006071692.1	0.963	Speckle-type POZ protein-like isoform X1
18	89462.XP_006066845.1	0.960	Ankyrin repeat and SOCS box protein 1
19	89462.XP_006074393.1	0.951	Suppressor of cytokine signaling 7 isoform X1
20	89462.XP_006053814.1	0.948	Ankyrin repeat and SOCS box protein 7 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.984	catalytic activity
GO:0004842	0.972	ubiquitin-protein transferase activity
GO:0031625	0.970	ubiquitin protein ligase binding
GO:0060089	0.603	molecular transducer activity
GO:0038023	0.558	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0009987	0.989	cellular process
GO:0036211	0.985	protein modification process
GO:0070647	0.976	protein modification by small protein conjugation or removal
GO:0065007	0.975	biological regulation
GO:0050789	0.971	regulation of biological process
GO:0050896	0.950	response to stimulus
GO:0050794	0.941	regulation of cellular process
GO:0016567	0.762	protein ubiquitination
GO:0044237	0.645	cellular metabolic process
GO:0044260	0.516	cellular macromolecule metabolic process
GO:0006508	0.498	proteolysis
GO:0009056	0.475	catabolic process
GO:0051716	0.458	cellular response to stimulus
GO:1901575	0.426	organic substance catabolic process
GO:0048519	0.410	negative regulation of biological process
GO:1901565	0.409	organonitrogen compound catabolic process
GO:0044248	0.398	cellular catabolic process
GO:0048523	0.370	negative regulation of cellular process
GO:0006950	0.322	response to stress
GO:0030163	0.321	protein catabolic process
GO:0023052	0.300	signaling
GO:0007154	0.300	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.998	cytosol
GO:0031461	0.996	cullin-RING ubiquitin ligase complex
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005634	0.972	nucleus
GO:0005654	0.956	nucleoplasm
GO:0043232	0.921	intracellular non-membrane-bounded organelle
GO:0016020	0.732	membrane
GO:0071944	0.322	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.973	Transferases.

[back to server]