StarFunc result for job id Q93045

User Input

>input (179 residues)
MAKTAMAYKEKMKELSMLSLICSCFYPEPRNINIYTYDDMEVKQINKRASGQAFELILKP
PSPISEAPRTLASPKKKDLSLEEIQKKLEAAEERRKSQEAQVLKQLAEKREHEREVLQKA
LEENNNFSKMAEEKLILKMEQIKENREANLAAIIERLQEKERHAAEVRRNKELQVELSG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P21818	0.986	0.986	6.124E-24	179	0.994	0.994	P21818.pdb.gz	STMN2_RAT Stathmin-2 OS=Rattus norvegicus OX=10116 GN=Stmn2 PE=1 SV=2
2	AFDB:E7FE68	0.813	0.809	3.418E-18	180	0.760	0.756	E7FE68.pdb.gz	E7FE68_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:92905 PE=3 SV=1
3	AFDB:Q4VBT7	0.795	0.791	6.692E-18	180	0.737	0.733	Q4VBT7.pdb.gz	Q4VBT7_DANRE Stathmin OS=Danio rerio OX=7955 GN=scg10 PE=2 SV=1
4	AFDB:O70166	0.826	0.822	1.765E-15	180	0.732	0.728	O70166.pdb.gz	STMN3_MOUSE Stathmin-3 OS=Mus musculus OX=10090 GN=Stmn3 PE=1 SV=1
5	AFDB:Q9H169	0.643	0.614	3.627E-14	189	0.659	0.624	Q9H169.pdb.gz	STMN4_HUMAN Stathmin-4 OS=Homo sapiens OX=9606 GN=STMN4 PE=1 SV=1
6	AFDB:Q5XIY0	0.446	0.453	1.215E-13	175	0.547	0.560	Q5XIY0.pdb.gz
7	AFDB:Q5RIC7	0.653	0.626	6.091E-13	188	0.603	0.574	Q5RIC7.pdb.gz	Q5RIC7_DANRE Stathmin OS=Danio rerio OX=7955 GN=wu:fj44e06 PE=3 SV=1
8	AFDB:P13668	0.723	0.863	2.620E-11	149	0.559	0.671	P13668.pdb.gz	STMN1_RAT Stathmin OS=Rattus norvegicus OX=10116 GN=Stmn1 PE=1 SV=2
9	AFDB:M9NEA1	0.547	0.272	9.593E-5	381	0.279	0.131	M9NEA1.pdb.gz	M9NEA1_DROME Stathmin, isoform D OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=1
10	AFDB:Q8IPK0	0.555	0.344	2.810E-4	302	0.274	0.162	Q8IPK0.pdb.gz	Q8IPK0_DROME Stathmin, isoform B OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=1
11	PDB:7f8xA	0.106	0.048	3.240	443	0.017	0.007	7f8xA.pdb.gz	Structures of the human cholecystokinin receptors bound to agonists and antagonists.
12	PDB:7qdsA	0.090	0.100	3.240	155	0.050	0.058	7qdsA.pdb.gz
13	PDB:7f5sLE	0.102	0.086	3.705	223	0.089	0.072	7f5sLE.pdb.gz	METTL18-mediated histidine methylation of RPL3 modulates translation elongation for proteostasis maintenance.
14	PDB:2qbyA	0.093	0.049	4.238	366	0.028	0.014	2qbyA.pdb.gz	Replication origin recognition and deformation by a heterodimeric archaeal Orc1 complex.
15	PDB:7odrO	0.108	0.124	4.238	154	0.078	0.091	7odrO.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
16	PDB:2ehjA	0.077	0.069	4.848	208	0.022	0.019	2ehjA.pdb.gz
17	PDB:6ahyB	0.095	0.058	4.848	313	0.039	0.022	6ahyB.pdb.gz
18	PDB:5e38B	0.093	0.095	5.184	175	0.034	0.034	5e38B.pdb.gz
19	PDB:6gg3E	0.107	0.042	5.184	481	0.045	0.017	6gg3E.pdb.gz	An allostatic mechanism for M2 pyruvate kinase as an amino-acid sensor.
20	PDB:6htsR	0.088	0.187	5.184	72	0.034	0.083	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P55821	7.36e-126	353	179	1.000	1.000	STMN2_MOUSE Stathmin-2 OS=Mus musculus OX=10090 GN=Stmn2 PE=1 SV=1
2	Q93045	7.36e-126	353	179	1.000	1.000	STMN2_HUMAN Stathmin-2 OS=Homo sapiens OX=9606 GN=STMN2 PE=1 SV=3
3	P21818	4.65e-125	351	179	0.994	0.994	STMN2_RAT Stathmin-2 OS=Rattus norvegicus OX=10116 GN=Stmn2 PE=1 SV=2
4	E7FE68	5.45e-92	267	180	0.760	0.756	E7FE68_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:92905 PE=3 SV=1
5	Q4VBT7	2.94e-89	260	180	0.737	0.733	Q4VBT7_DANRE Stathmin OS=Danio rerio OX=7955 GN=scg10 PE=2 SV=1
6	O70166	3.17e-84	248	180	0.732	0.728	STMN3_MOUSE Stathmin-3 OS=Mus musculus OX=10090 GN=Stmn3 PE=1 SV=1
7	Q9NZ72	4.31e-84	247	180	0.732	0.728	STMN3_HUMAN Stathmin-3 OS=Homo sapiens OX=9606 GN=STMN3 PE=1 SV=3
8	Q9JHU6	1.33e-83	246	180	0.732	0.728	STMN3_RAT Stathmin-3 OS=Rattus norvegicus OX=10116 GN=Stmn3 PE=1 SV=1
9	A0A0J9YW36	6.73e-81	241	239	0.715	0.536	A0A0J9YW36_HUMAN Stathmin 3 (Fragment) OS=Homo sapiens OX=9606 GN=STMN3 PE=1 SV=1
10	Q9H169	1.75e-69	211	189	0.665	0.630	STMN4_HUMAN Stathmin-4 OS=Homo sapiens OX=9606 GN=STMN4 PE=1 SV=1
11	Q5RIC7	3.06e-61	190	188	0.620	0.590	Q5RIC7_DANRE Stathmin OS=Danio rerio OX=7955 GN=wu:fj44e06 PE=3 SV=1
12	Q6PBU3	3.30e-61	189	188	0.620	0.590	Q6PBU3_DANRE Stathmin OS=Danio rerio OX=7955 GN=zgc:73243 PE=2 SV=1
13	P54227	7.88e-59	182	149	0.559	0.671	STMN1_MOUSE Stathmin OS=Mus musculus OX=10090 GN=Stmn1 PE=1 SV=2
14	P13668	1.26e-58	182	149	0.559	0.671	STMN1_RAT Stathmin OS=Rattus norvegicus OX=10116 GN=Stmn1 PE=1 SV=2
15	P16949	2.57e-58	181	149	0.559	0.671	STMN1_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3
16	P31395	7.66e-58	179	148	0.553	0.669	STMN1_CHICK Stathmin OS=Gallus gallus OX=9031 GN=STMN1 PE=1 SV=1
17	Q96CE4	8.08e-58	179	149	0.553	0.664	Q96CE4_HUMAN Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=1
18	Q9GQR4	2.05e-10	58.9	174	0.263	0.270	Q9GQR4_DROME Stathmin (Fragment) OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1
19	Q9VMH3	3.42e-10	59.3	250	0.268	0.192	Q9VMH3_DROME LD04103p OS=Drosophila melanogaster OX=7227 GN=stai PE=1 SV=2
20	Q9GQR6	5.62e-10	58.5	234	0.263	0.201	Q9GQR6_DROME Stathmin-1 OS=Drosophila melanogaster OX=7227 GN=stai PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00836 Stathmin	9.8e-52	185.9	Stathmin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 885580.XP_010634534.1

Rank	PPI partner	STRING score	Description
1	885580.XP_010601395.1	0.656	Belongs to the transient receptor (TC 1.A.4) family.
2	885580.XP_010628484.1	0.646	Neuromodulin
3	885580.XP_010638465.1	0.589	Retinoic acid receptor beta
4	885580.XP_010643700.1	0.575	Regulator of G-protein signaling 6
5	885580.XP_010625935.1	0.571	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
6	885580.XP_010609405.1	0.564	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 21 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 1 sample with support for all annotated introns
7	885580.XP_010622604.1	0.537	Microtubule-associated protein 4 isoform X1
8	885580.XP_010641746.1	0.520	Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain.
9	885580.XP_010613470.1	0.508	Belongs to the universal ribosomal protein uS15 family.
10	885580.XP_010628443.1	0.506	Belongs to the calponin family.
11	885580.XP_010632801.1	0.506	Sulfotransferase 4A1
12	885580.XP_010607521.1	0.502	chromogranin-A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0032501	0.948	multicellular organismal process
GO:0009987	0.923	cellular process
GO:0048856	0.912	anatomical structure development
GO:0007275	0.875	multicellular organism development
GO:0048731	0.873	system development
GO:0007399	0.850	nervous system development
GO:0043254	0.846	regulation of protein-containing complex assembly
GO:1902904	0.844	negative regulation of supramolecular fiber organization
GO:0032271	0.817	regulation of protein polymerization
GO:0031110	0.687	regulation of microtubule polymerization or depolymerization
GO:0048518	0.685	positive regulation of biological process
GO:0010639	0.629	negative regulation of organelle organization
GO:0050896	0.613	response to stimulus
GO:0051494	0.608	negative regulation of cytoskeleton organization
GO:0031111	0.584	negative regulation of microtubule polymerization or depolymerization
GO:0071840	0.521	cellular component organization or biogenesis
GO:0048522	0.485	positive regulation of cellular process
GO:0016043	0.471	cellular component organization
GO:0043244	0.400	regulation of protein-containing complex disassembly
GO:0048869	0.370	cellular developmental process
GO:0030154	0.347	cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0012505	0.994	endomembrane system
GO:0043005	0.986	neuron projection
GO:0030424	0.981	axon
GO:0043226	0.975	organelle
GO:0043229	0.972	intracellular organelle
GO:0043231	0.956	intracellular membrane-bounded organelle
GO:0030427	0.914	site of polarized growth
GO:0005829	0.894	cytosol
GO:0150034	0.894	distal axon
GO:0030426	0.851	growth cone
GO:0005794	0.758	Golgi apparatus
GO:0036477	0.403	somatodendritic compartment
GO:0044297	0.388	cell body
GO:0016020	0.307	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]