StarFunc result for job id Q93062

User Input

>input (196 residues)
MNNGGKAEKENTPSEANLQEEEVRTLFVSGLPLDIKPRELYLLFRPFKGYEGSLIKLTSK
QPVGFVSFDSRSEAEAAKNALNGIRFDPEIPQTLRLEFAKANTKMAKNKLVGTPNPSTPL
PNTVPQFIAREPYELTVPALYPSSPEVWAPYPLYPAELAPALPPPAFTYPASLHAQMRWL
PPSEATSQGWKSRQFC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B4E3T4	0.499	0.441	6.878E-28	224	0.913	0.799	B4E3T4.pdb.gz	B4E3T4_HUMAN HCG2043421, isoform CRA_c OS=Homo sapiens OX=9606 GN=RBPMS PE=1 SV=1
2	AFDB:Q9W6I1	0.567	0.559	2.238E-26	200	0.760	0.745	Q9W6I1.pdb.gz	RBPS2_CHICK RNA-binding protein with multiple splicing 2 OS=Gallus gallus OX=9031 GN=RBPMS2 PE=1 SV=1
3	AFDB:Q6ZRY4	0.547	0.516	1.409E-25	209	0.704	0.660	Q6ZRY4.pdb.gz	RBPS2_HUMAN RNA-binding protein with multiple splicing 2 OS=Homo sapiens OX=9606 GN=RBPMS2 PE=1 SV=1
4	AFDB:Q7ZUL7	0.586	0.575	2.902E-25	200	0.724	0.710	Q7ZUL7.pdb.gz	Q7ZUL7_DANRE RNA binding protein OS=Danio rerio OX=7955 GN=rbpms2 PE=1 SV=1
5	AFDB:E7F9Q3	0.418	0.503	2.194E-19	160	0.571	0.700	E7F9Q3.pdb.gz
6	AFDB:G5ECJ4	0.455	0.291	3.445E-16	312	0.418	0.263	G5ECJ4.pdb.gz	G5ECJ4_CAEEL Mec-8 protein OS=Caenorhabditis elegans OX=6239 GN=mec-8 PE=1 SV=1
7	AFDB:Q01617	0.474	0.167	1.369E-15	606	0.469	0.152	Q01617.pdb.gz	CPO_DROME Protein couch potato OS=Drosophila melanogaster OX=7227 GN=cpo PE=2 SV=4
8	AFDB:Q9ASW4	0.430	0.253	9.099E-11	339	0.301	0.174	Q9ASW4.pdb.gz	Q9ASW4_ARATH AT3G21215 protein OS=Arabidopsis thaliana OX=3702 GN=At3g21215 PE=1 SV=1
9	AFDB:P16914	0.365	0.157	1.745E-8	483	0.199	0.081	P16914.pdb.gz	ELAV_DROME Protein elav OS=Drosophila melanogaster OX=7227 GN=elav PE=2 SV=1
10	AFDB:Q9LEB3	0.364	0.174	3.840E-8	428	0.158	0.072	Q9LEB3.pdb.gz	RBP47_NICPL Polyadenylate-binding protein RBP47 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP47 PE=1 SV=1
11	PDB:3lqvB	0.350	0.572	1.330E-5	115	0.087	0.148	3lqvB.pdb.gz	Branch Recognition by SF3b14
12	PDB:6exnY	0.373	0.781	1.730E-5	87	0.133	0.299	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
13	PDB:6ff7X	0.370	0.421	2.250E-5	171	0.107	0.123	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
14	PDB:6gd1A	0.335	0.345	2.403E-5	190	0.102	0.105	6gd1A.pdb.gz
15	PDB:1hl6A	0.339	0.540	2.740E-5	119	0.102	0.168	1hl6A.pdb.gz
16	PDB:5xjcw	0.353	0.721	3.806E-5	91	0.082	0.176	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
17	PDB:5yzg1	0.333	0.272	4.065E-5	243	0.112	0.091	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
18	PDB:7dvqY	0.355	0.486	5.286E-5	140	0.071	0.100	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:5lsbA	0.353	0.391	5.646E-5	176	0.102	0.114	5lsbA.pdb.gz
20	PDB:6qx91K	0.343	0.335	1.615E-4	201	0.077	0.075	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q93062	7.18e-142	395	196	1.000	1.000	RBPMS_HUMAN RNA-binding protein with multiple splicing OS=Homo sapiens OX=9606 GN=RBPMS PE=1 SV=1
2	B4E3T4	4.84e-125	353	224	0.898	0.786	B4E3T4_HUMAN HCG2043421, isoform CRA_c OS=Homo sapiens OX=9606 GN=RBPMS PE=1 SV=1
3	Q7ZUL7	6.83e-94	273	200	0.714	0.700	Q7ZUL7_DANRE RNA binding protein OS=Danio rerio OX=7955 GN=rbpms2 PE=1 SV=1
4	Q9W6I1	7.92e-92	268	200	0.750	0.735	RBPS2_CHICK RNA-binding protein with multiple splicing 2 OS=Gallus gallus OX=9031 GN=RBPMS2 PE=1 SV=1
5	Q6DH13	1.08e-87	258	199	0.714	0.704	RBP2A_DANRE RNA-binding protein, mRNA-processing factor 2a OS=Danio rerio OX=7955 GN=rbpms2a PE=1 SV=1
6	Q6ZRY4	1.34e-84	250	209	0.679	0.636	RBPS2_HUMAN RNA-binding protein with multiple splicing 2 OS=Homo sapiens OX=9606 GN=RBPMS2 PE=1 SV=1
7	E5RJ31	3.10e-44	145	120	0.367	0.600	E5RJ31_HUMAN RNA binding protein, mRNA processing factor OS=Homo sapiens OX=9606 GN=RBPMS PE=1 SV=1
8	E5RFP4	1.41e-43	143	115	0.367	0.626	E5RFP4_HUMAN RNA binding protein, mRNA processing factor OS=Homo sapiens OX=9606 GN=RBPMS PE=1 SV=1
9	Q01617	6.35e-41	147	606	0.388	0.125	CPO_DROME Protein couch potato OS=Drosophila melanogaster OX=7227 GN=cpo PE=2 SV=4
10	G5ECJ4	1.35e-33	123	312	0.357	0.224	G5ECJ4_CAEEL Mec-8 protein OS=Caenorhabditis elegans OX=6239 GN=mec-8 PE=1 SV=1
11	E5RJD7	3.98e-27	99.4	49	0.250	1.000	E5RJD7_HUMAN RNA binding protein, mRNA processing factor (Fragment) OS=Homo sapiens OX=9606 GN=RBPMS PE=1 SV=1
12	Q9ASW4	1.45e-14	72.8	339	0.194	0.112	Q9ASW4_ARATH AT3G21215 protein OS=Arabidopsis thaliana OX=3702 GN=At3g21215 PE=1 SV=1
13	Q2L4W6	9.31e-06	47.8	567	0.138	0.048	SPO5_SCHPO Sporulation-specific protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spo5 PE=1 SV=1
14	Q9FI86	5.07e-05	45.1	308	0.173	0.110	Q9FI86_ARATH Eukaryotic translation initiation factor 3 subunit G OS=Arabidopsis thaliana OX=3702 GN=EIF3G2 PE=3 SV=1
15	O22315	6.52e-05	44.7	303	0.143	0.092	SR34_ARATH Serine/arginine-rich-splicing factor SR34 OS=Arabidopsis thaliana OX=3702 GN=SR34 PE=1 SV=1
16	Q9LEB4	7.85e-05	44.7	409	0.122	0.059	RBP45_NICPL Polyadenylate-binding protein RBP45 OS=Nicotiana plumbaginifolia OX=4092 GN=RBP45 PE=1 SV=1
17	A0A2R8S0A2	1.56e-04	43.9	389	0.148	0.075	A0A2R8S0A2_DANRE ELAV-like protein OS=Danio rerio OX=7955 GN=zgc:91918 PE=1 SV=1
18	Q6GQM6	1.71e-04	43.5	360	0.148	0.081	Q6GQM6_DANRE ELAV-like protein OS=Danio rerio OX=7955 GN=zgc:91918 PE=2 SV=1
19	P16914	1.89e-04	43.5	483	0.138	0.056	ELAV_DROME Protein elav OS=Drosophila melanogaster OX=7227 GN=elav PE=2 SV=1
20	Q20084	1.90e-04	43.5	456	0.133	0.057	Q20084_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=exc-7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	1.9e-08	45.4	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 59463.ENSMLUP00000008560

Rank	PPI partner	STRING score	Description
1	59463.ENSMLUP00000002570	0.899	QKI, KH domain containing, RNA binding
2	59463.ENSMLUP00000002435	0.861	RNA binding protein fox-1 homolog
3	59463.ENSMLUP00000003694	0.709	KH domain containing, RNA binding, signal transduction associated 3
4	59463.ENSMLUP00000005005	0.709	KH domain containing, RNA binding, signal transduction associated 2
5	59463.ENSMLUP00000007406	0.709	KH domain containing, RNA binding, signal transduction associated 1
6	59463.ENSMLUP00000012187	0.687	RNA binding protein with multiple splicing 2
7	59463.ENSMLUP00000011509	0.633	Homeobox protein
8	59463.ENSMLUP00000019474	0.633	annotation not available
9	59463.ENSMLUP00000005222	0.625	Uncharacterized protein
10	59463.ENSMLUP00000007342	0.603	Uncharacterized protein
11	59463.ENSMLUP00000015231	0.603	NOVA alternative splicing regulator 1
12	59463.ENSMLUP00000021759	0.590	Dynactin 6
13	59463.ENSMLUP00000004532	0.579	Opsin 4
14	59463.ENSMLUP00000014485	0.573	RNA binding protein, fox-1 homolog (C. elegans) 1
15	59463.ENSMLUP00000008750	0.564	Cleavage and polyadenylation specific factor 4-like
16	59463.ENSMLUP00000016838	0.561	Uncharacterized protein
17	59463.ENSMLUP00000001565	0.560	PTPRF interacting protein alpha 1
18	59463.ENSMLUP00000002970	0.557	PTPRF interacting protein, binding protein 1 (liprin beta 1)
19	59463.ENSMLUP00000007132	0.536	Transcription initiation factor IIE subunit beta
20	59463.ENSMLUP00000001943	0.535	annotation not available

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003729	1.000	mRNA binding
GO:0046983	0.774	protein dimerization activity
GO:0070717	0.769	poly-purine tract binding
GO:0042802	0.764	identical protein binding
GO:0008143	0.733	poly(A) binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0031323	0.926	regulation of cellular metabolic process
GO:0071704	0.919	organic substance metabolic process
GO:0044238	0.918	primary metabolic process
GO:0044237	0.915	cellular metabolic process
GO:0006807	0.898	nitrogen compound metabolic process
GO:0043170	0.874	macromolecule metabolic process
GO:0050896	0.842	response to stimulus
GO:0060255	0.816	regulation of macromolecule metabolic process
GO:0080090	0.722	regulation of primary metabolic process
GO:0051171	0.722	regulation of nitrogen compound metabolic process
GO:0048518	0.700	positive regulation of biological process
GO:0032502	0.695	developmental process
GO:0032501	0.691	multicellular organismal process
GO:0048522	0.633	positive regulation of cellular process
GO:0023051	0.623	regulation of signaling
GO:0010646	0.610	regulation of cell communication
GO:0048856	0.550	anatomical structure development
GO:0051174	0.536	regulation of phosphorus metabolic process
GO:0048583	0.510	regulation of response to stimulus
GO:0007275	0.448	multicellular organism development
GO:0090304	0.446	nucleic acid metabolic process
GO:0010467	0.441	gene expression
GO:0048519	0.439	negative regulation of biological process
GO:0006396	0.409	RNA processing
GO:0048523	0.373	negative regulation of cellular process
GO:0010468	0.361	regulation of gene expression
GO:0009966	0.358	regulation of signal transduction
GO:0019219	0.312	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0031981	0.992	nuclear lumen
GO:0005654	0.983	nucleoplasm
GO:0005829	0.883	cytosol
GO:0043228	0.845	non-membrane-bounded organelle
GO:0043232	0.841	intracellular non-membrane-bounded organelle
GO:0099080	0.523	supramolecular complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]