StarFunc result for job id Q93074

User Input

>input (2177 residues)
MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEHGSAK
NVSFNPAKISSNFSSIIAEKLRCNTLPDTGRRKPQVNQKDNFWLVTARSQSAINTWFTDL
AGTKPLTQLAKKVPIFSKKEEVFGYLAKYTVPVMRAAWLIKMTCAYYAAISETKVKKRHV
DPFMEWTQIITKYLWEQLQKMAEYYRPGPAGSGGCGSTIGPLPHDVEVAIRQWDYTEKLA
MFMFQDGMLDRHEFLTWVLECFEKIRPGEDELLKLLLPLLLRYSGEFVQSAYLSRRLAYF
CTRRLALQLDGVSSHSSHVISAQSTSTLPTTPAPQPPTSSTPSTPFSDLLMCPQHRPLVF
GLSCILQTILLCCPSALVWHYSLTDSRIKTGSPLDHLPIAPSNLPMPEGNSAFTQQVRAK
LREIEQQIKERGQAVEVRWSFDKCQEATAGFTIGRVLHTLEVLDSHSFERSDFSNSLDSL
CNRIFGLGPSKDGHEISSDDDAVVSLLCEWAVSCKRSGRHRAMVVAKLLEKRQAEIEAER
CGESEAADEKGSIASGSLSAPSAPIFQDVLLQFLDTQAPMLTDPRSESERVEFFNLVLLF
CELIRHDVFSHNMYTCTLISRGDLAFGAPGPRPPSPFDDPADDPEHKEAEGSSSSKLEDP
GLSESMDIDPSSSVLFEDMEKPDFSLFSPTMPCEGKGSPSPEKPDVEKEVKPPPKEKIEG
TLGVLYDQPRHVQYATHFPIPQEESCSHECNQRLVVLFGVGKQRDDARHAIKKITKDILK
VLNRKGTAETDQLAPIVPLNPGDLTFLGGEDGQKRRRNRPEAFPTAEDIFAKFQHLSHYD
QHQVTAQVSRNVLEQITSFALGMSYHLPLVQHVQFIFDLMEYSLSISGLIDFAIQLLNEL
SVVEAELLLKSSDLVGSYTTSLCLCIVAVLRHYHACLILNQDQMAQVFEGLCGVVKHGMN
RSDGSSAERCILAYLYDLYTSCSHLKNKFGELFSDFCSKVKNTIYCNVEPSESNMRWAPE
FMIDTLENPAAHTFTYTGLGKSLSENPANRYSFVCNALMHVCVGHHDPDRVNDIAILCAE
LTGYCKSLSAEWLGVLKALCCSSNNGTCGFNDLLCNVDVSDLSFHDSLATFVAILIARQC
LLLEDLIRCAAIPSLLNAACSEQDSEPGARLTCRILLHLFKTPQLNPCQSDGNKPTVGIR
SSCDRHLLAASQNRIVDGAVFAVLKAVFVLGDAELKGSGFTVTGGTEELPEEEGGGGSGG
RRQGGRNISVETASLDVYAKYVLRSICQQEWVGERCLKSLCEDSNDLQDPVLSSAQAQRL
MQLICYPHRLLDNEDGENPQRQRIKRILQNLDQWTMRQSSLELQLMIKQTPNNEMNSLLE
NIAKATIEVFQQSAETGSSSGSTASNMPSSSKTKPVLSSLERSGVWLVAPLIAKLPTSVQ
GHVLKAAGEELEKGQHLGSSSRKERDRQKQKSMSLLSQQPFLSLVLTCLKGQDEQREGLL
TSLYSQVHQIVNNWRDDQYLDDCKPKQLMHEALKLRLNLVGGMFDTVQRSTQQTTEWAML
LLEIIISGTVDMQSNNELFTTVLDMLSVLINGTLAADMSSISQGSMEENKRAYMNLAKKL
QKELGERQSDSLEKVRQLLPLPKQTRDVITCEPQGSLIDTKGNKIAGFDSIFKKEGLQVS
TKQKISPWDLFEGLKPSAPLSWGWFGTVRVDRRVARGEEQQRLLLYHTHLRPRPRAYYLE
PLPLPPEDEEPPAPTLLEPEKKAPEPPKTDKPGAAPPSTEERKKKSTKGKKRSQPATKTE
DYGMGPGRSGPYGVTVPPDLLHHPNPGSITHLNYRQGSIGLYTQNQPLPAGGPRVDPYRP
VRLPMQKLPTRPTYPGVLPTTMTGVMGLEPSSYKTSVYRQQQPAVPQGQRLRQQLQQSQG
MLGQSSVHQMTPSSSYGLQTSQGYTPYVSHVGLQQHTGPAGTMVPPSYSSQPYQSTHPST
NPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTSTQRFSHQTLQQTPMISTMTPMSAQGVQA
GVRSTAILPEQQQQQQQQQQQQQQQQQQQQQQQQQQYHIRQQQQQQILRQQQQQQQQQQQ
QQQQQQQQQQQQQQQHQQQQQQQAAPPQPQPQSQPQFQRQGLQQTQQQQQTAALVRQLQQ
QLSNTQPQPSTNIFGRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A096MKF8	0.812	0.808	0.000	2190	0.970	0.964	A0A096MKF8.pdb.gz	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
2	AFDB:Q2QCI8	0.735	0.737	0.000	2173	0.729	0.730	Q2QCI8.pdb.gz	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
3	AFDB:Q86YW9	0.690	0.699	0.000	2145	0.595	0.604	Q86YW9.pdb.gz	MD12L_HUMAN Mediator of RNA polymerase II transcription subunit 12-like protein OS=Homo sapiens OX=9606 GN=MED12L PE=1 SV=2
4	AFDB:F4J8G7	0.096	0.097	8.708E-8	2138	0.131	0.134	F4J8G7.pdb.gz	VIR_ARATH Protein virilizer homolog OS=Arabidopsis thaliana OX=3702 GN=VIR PE=1 SV=1
5	PDB:7kpxC	0.191	0.272	4.169E-7	1352	0.079	0.126	7kpxC.pdb.gz
6	AFDB:Q13936	0.055	0.055	1.388E-6	2221	0.124	0.122	Q13936.pdb.gz	CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens OX=9606 GN=CACNA1C PE=1 SV=4
7	AFDB:F4HRS2	0.084	0.083	1.669E-6	2222	0.104	0.102	F4HRS2.pdb.gz	SWTIE_ARATH Protein SWEETIE OS=Arabidopsis thaliana OX=3702 GN=SWEETIE PE=1 SV=2
8	AFDB:Q5UIP0	0.097	0.089	2.600E-6	2472	0.085	0.074	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
9	AFDB:Q6PR54	0.081	0.076	2.904E-6	2419	0.084	0.076	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
10	AFDB:Q8IZD9	0.079	0.083	6.789E-6	2030	0.073	0.078	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1
11	AFDB:Q01668	0.056	0.057	8.791E-6	2161	0.117	0.118	Q01668.pdb.gz	CAC1D_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1D OS=Homo sapiens OX=9606 GN=CACNA1D PE=1 SV=2
12	PDB:7kpvC	0.107	0.407	3.250E-5	487	0.029	0.129	7kpvC.pdb.gz
13	PDB:7mqaLM	0.080	0.084	3.372E-5	2041	0.090	0.097	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7sukSP	0.094	0.094	5.061E-5	2234	0.092	0.090	7sukSP.pdb.gz	Artificial intelligence-assisted cryoEM structure of Bfr2-Lcp5 complex observed in the yeast small subunit processome.
15	PDB:7mopA	0.086	0.079	1.649E-4	2445	0.079	0.070	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
16	PDB:7jq9A	0.085	0.079	3.451E-4	2427	0.080	0.072	7jq9A.pdb.gz
17	PDB:7sglA	0.079	0.057	4.307E-4	3852	0.094	0.053	7sglA.pdb.gz	Autophosphorylation transforms DNA-PK from protecting to processing DNA ends.
18	PDB:7mqaSP	0.093	0.086	6.004E-4	2485	0.090	0.078	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
19	PDB:7vf2A	0.097	0.139	7.221E-4	1196	0.058	0.105	7vf2A.pdb.gz
20	PDB:7mq8SP	0.078	0.083	8.370E-4	1993	0.091	0.100	7mq8SP.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A096MKF8	0.0	4354	2190	0.971	0.965	A0A096MKF8_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
2	A0A0G2K4W3	0.0	4286	2169	0.959	0.963	A0A0G2K4W3_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=2
3	A0A8I6A1Z4	0.0	4081	2020	0.899	0.969	A0A8I6A1Z4_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=1
4	A2AGH6	0.0	4371	2190	0.973	0.968	MED12_MOUSE Mediator of RNA polymerase II transcription subunit 12 OS=Mus musculus OX=10090 GN=Med12 PE=1 SV=1
5	D3ZDE6	0.0	4252	2156	0.948	0.957	D3ZDE6_RAT Mediator complex subunit 12 OS=Rattus norvegicus OX=10116 GN=Med12 PE=1 SV=3
6	Q2QCI8	0.0	2974	2173	0.699	0.700	MED12_DANRE Mediator of RNA polymerase II transcription subunit 12 OS=Danio rerio OX=7955 GN=med12 PE=2 SV=1
7	Q86YW9	0.0	2323	2145	0.577	0.586	MD12L_HUMAN Mediator of RNA polymerase II transcription subunit 12-like protein OS=Homo sapiens OX=9606 GN=MED12L PE=1 SV=2
8	Q93074	0.0	4508	2177	1.000	1.000	MED12_HUMAN Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12 PE=1 SV=4
9	Q9VW47	0.0	708	2531	0.208	0.179	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
10	Q20497	1.14e-19	99.8	3498	0.036	0.023	MED12_CAEEL Mediator of RNA polymerase II transcription subunit 12 OS=Caenorhabditis elegans OX=6239 GN=dpy-22 PE=1 SV=2
11	Q8IDX6	5.31e-07	57.8	3130	0.013	0.009	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
12	C0H5F4	0.63	37.7	3254	0.011	0.007	RH2B_PLAF7 Reticulocyte-binding protein homolog 2b OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2b PE=1 SV=2
13	M9PHD8	6.7	34.3	1714	0.010	0.013	M9PHD8_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=3 SV=1
14	Q07DP5	7.0	34.3	1715	0.010	0.013	Q07DP5_DROME TATA box-binding protein-like 1 OS=Drosophila melanogaster OX=7227 GN=Trf2 PE=2 SV=1
15	Q55DM1	7.9	34.3	3619	0.007	0.004	LVSA_DICDI BEACH domain-containing protein lvsA OS=Dictyostelium discoideum OX=44689 GN=lvsA PE=4 SV=2
16	A0A0B4K7S6	8.2	34.3	1965	0.017	0.018	A0A0B4K7S6_DROME Molting defective, isoform D OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1
17	A0A0C4DHB7	9.4	33.9	1943	0.017	0.019	A0A0C4DHB7_DROME Molting defective, isoform E OS=Drosophila melanogaster OX=7227 GN=mld PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09497 Med12	1.5e-10	52.5	Transcription mediator complex subunit Med12
2	PF12145 Med12-LCEWAV	2.2e-180	612.3	Eukaryotic Mediator 12 subunit domain
3	PF12144 Med12-PQL	4.5e-76	266.9	Eukaryotic Mediator 12 catenin-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363193

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370938	0.999	Cyclin-dependent kinase 8
2	9606.ENSP00000380888	0.999	Mediator of RNA polymerase II transcription subunit 13
3	9606.ENSP00000428982	0.999	Cyclin-C
4	9606.ENSP00000281928	0.998	Mediator of RNA polymerase II transcription subunit 13-like
5	9606.ENSP00000300651	0.998	Mediator of RNA polymerase II transcription subunit 1
6	9606.ENSP00000323720	0.998	Mediator of RNA polymerase II transcription subunit 14
7	9606.ENSP00000344456	0.998	Catenin beta-1
8	9606.ENSP00000251871	0.996	Mediator of RNA polymerase II transcription subunit 17
9	9606.ENSP00000325612	0.996	Mediator of RNA polymerase II transcription subunit 16
10	9606.ENSP00000357907	0.996	Cyclin dependent kinase 19
11	9606.ENSP00000362948	0.996	Mediator of RNA polymerase II transcription subunit 18
12	9606.ENSP00000481920	0.996	Mediator of RNA polymerase II transcription subunit 6
13	9606.ENSP00000258648	0.995	Mediator of RNA polymerase II transcription subunit 4
14	9606.ENSP00000297347	0.995	Mediator of RNA polymerase II transcription subunit 30
15	9606.ENSP00000255764	0.994	Mediator of RNA polymerase II transcription subunit 10
16	9606.ENSP00000290663	0.994	Mediator of RNA polymerase II transcription subunit 8
17	9606.ENSP00000314343	0.993	Mediator of RNA polymerase II transcription subunit 29
18	9606.ENSP00000337340	0.993	Mediator of RNA polymerase II transcription subunit 19
19	9606.ENSP00000263205	0.992	Mediator of RNA polymerase II transcription subunit 15
20	9606.ENSP00000282892	0.992	Mediator of RNA polymerase II transcription subunit 21

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061630	1.000	ubiquitin protein ligase activity
GO:0005488	0.975	binding
GO:0140110	0.965	transcription regulator activity
GO:0005515	0.962	protein binding
GO:0003712	0.568	transcription coregulator activity
GO:0097159	0.306	organic cyclic compound binding
GO:1901363	0.300	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0006807	0.993	nitrogen compound metabolic process
GO:0043170	0.992	macromolecule metabolic process
GO:0070647	0.975	protein modification by small protein conjugation or removal
GO:0050794	0.954	regulation of cellular process
GO:0016567	0.911	protein ubiquitination
GO:0019222	0.882	regulation of metabolic process
GO:0009987	0.881	cellular process
GO:0048518	0.867	positive regulation of biological process
GO:0060255	0.864	regulation of macromolecule metabolic process
GO:0051171	0.863	regulation of nitrogen compound metabolic process
GO:0080090	0.862	regulation of primary metabolic process
GO:0031323	0.856	regulation of cellular metabolic process
GO:0010468	0.850	regulation of gene expression
GO:0019219	0.849	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.823	regulation of biosynthetic process
GO:0010556	0.805	regulation of macromolecule biosynthetic process
GO:0031326	0.805	regulation of cellular biosynthetic process
GO:0048522	0.755	positive regulation of cellular process
GO:0051252	0.755	regulation of RNA metabolic process
GO:0006355	0.751	regulation of DNA-templated transcription
GO:0009893	0.675	positive regulation of metabolic process
GO:0010604	0.667	positive regulation of macromolecule metabolic process
GO:0051173	0.633	positive regulation of nitrogen compound metabolic process
GO:0031325	0.621	positive regulation of cellular metabolic process
GO:0006357	0.600	regulation of transcription by RNA polymerase II
GO:0050896	0.473	response to stimulus
GO:0051254	0.462	positive regulation of RNA metabolic process
GO:0045893	0.445	positive regulation of DNA-templated transcription
GO:0045944	0.384	positive regulation of transcription by RNA polymerase II
GO:0032502	0.332	developmental process
GO:0032501	0.322	multicellular organismal process
GO:0051716	0.319	cellular response to stimulus
GO:0044237	0.311	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005575	1.000	cellular_component
GO:0005654	0.993	nucleoplasm
GO:1902494	0.989	catalytic complex
GO:1990234	0.982	transferase complex
GO:0140535	0.954	intracellular protein-containing complex
GO:0140513	0.911	nuclear protein-containing complex
GO:0000151	0.890	ubiquitin ligase complex
GO:0016020	0.781	membrane
GO:0005737	0.520	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]