StarFunc result for job id Q93084

User Input

>input (999 residues)
MEAAHLLPAADVLRHFSVTAEGGLSPAQVTGARERYGPNELPSEEGKSLWELVLEQFEDL
LVRILLLAALVSFVLAWFEEGEETTTAFVEPLVIMLILVANAIVGVWQERNAESAIEALK
EYEPEMGKVIRSDRKGVQRIRARDIVPGDIVEVAVGDKVPADLRLIEIKSTTLRVDQSIL
TGESVSVTKHTEAIPDPRAVNQDKKNMLFSGTNITSGKAVGVAVATGLHTELGKIRSQMA
AVEPERTPLQRKLDEFGRQLSHAISVICVAVWVINIGHFADPAHGGSWLRGAVYYFKIAV
ALAVAAIPEGLPAVITTCLALGTRRMARKNAIVRSLPSVETLGCTSVICSDKTGTLTTNQ
MSVCRMFVVAEADAGSCLLHEFTISGTTYTPEGEVRQGDQPVRCGQFDGLVELATICALC
NDSALDYNEAKGVYEKVGEATETALTCLVEKMNVFDTDLQALSRVERAGACNTVIKQLMR
KEFTLEFSRDRKSMSVYCTPTRPHPTGQGSKMFVKGAPESVIERCSSVRVGSRTAPLTPT
SREQILAKIRDWGSGSDTLRCLALATRDAPPRKEDMELDDCSKFVQYETDLTFVGCVGML
DPPRPEVAACITRCYQAGIRVVMITGDNKGTAVAICRRLGIFGDTEDVAGKAYTGREFDD
LSPEQQRQACRTARCFARVEPAHKSRIVENLQSFNEITAMTGDGVNDAPALKKAEIGIAM
GSGTAVAKSAAEMVLSDDNFASIVAAVEEGRAIYSNMKQFIRYLISSNVGEVVCIFLTAI
LGLPEALIPVQLLWVNLVTDGLPATALGFNPPDLDIMEKLPRSPREALISGWLFFRYLAI
GVYVGLATVAAATWWFVYDAEGPHINFYQLRNFLKCSEDNPLFAGIDCEVFESRFPTTMA
LSVLVTIEMCNALNSVSENQSLLRMPPWMNPWLLVAVAMSMALHFLILLVPPLPLIFQVT
PLSGRQWVVVLQISLPVILLDEALKYLSRNHMHEEMSQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5zmwA	0.710	0.709	0.000	1000	0.750	0.749	5zmwA.pdb.gz	Mechanism of the E2 to E1 transition in Ca2+pump revealed by crystal structures of gating residue mutants.
2	PDB:7e7sA	0.701	0.688	0.000	1020	0.767	0.751	7e7sA.pdb.gz	Cryo-EM analysis provides new mechanistic insight into ATP binding to Ca 2+ -ATPase SERCA2b.
3	AFDB:A0A0R4IQS8	0.986	0.946	0.000	1041	0.765	0.734	A0A0R4IQS8.pdb.gz	A0A0R4IQS8_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1
4	AFDB:A9C3Q4	0.989	0.948	0.000	1042	0.758	0.726	A9C3Q4.pdb.gz
5	AFDB:G5EEK8	0.956	0.903	0.000	1059	0.684	0.645	G5EEK8.pdb.gz	G5EEK8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
6	AFDB:O14983	0.992	0.990	0.000	1001	0.761	0.759	O14983.pdb.gz	AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2A1 PE=1 SV=1
7	AFDB:O55143	0.987	0.944	0.000	1044	0.766	0.733	O55143.pdb.gz	AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus OX=10090 GN=Atp2a2 PE=1 SV=2
8	AFDB:P18596	0.999	0.999	0.000	999	0.943	0.943	P18596.pdb.gz	AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2a3 PE=1 SV=3
9	AFDB:P22700	0.991	0.971	0.000	1020	0.674	0.660	P22700.pdb.gz	ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2
10	AFDB:Q5U3A4	0.995	0.989	0.000	1005	0.757	0.752	Q5U3A4.pdb.gz
11	AFDB:Q9SY55	0.946	0.946	1.573E-102	998	0.545	0.545	Q9SY55.pdb.gz	ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA3 PE=1 SV=3
12	AFDB:Q9UUY0	0.872	0.873	5.742E-102	997	0.534	0.535	Q9UUY0.pdb.gz	Q9UUY0_NEUCS Putative calcium P-type ATPase (Fragment) OS=Neurospora crassa OX=5141 GN=nca-1 PE=4 SV=1
13	PDB:7x20A	0.810	0.819	5.744E-55	986	0.283	0.287	7x20A.pdb.gz	Structure and function of H + /K + pump mutants reveal Na + /K + pump mechanisms.
14	PDB:8d3xA	0.840	0.848	5.659E-54	989	0.286	0.289	8d3xA.pdb.gz	Structural basis for gating mechanism of the human sodium-potassium pump.
15	PDB:3ixzA	0.833	0.834	1.342E-53	998	0.292	0.293	3ixzA.pdb.gz
16	PDB:3b8eA	0.839	0.840	4.825E-52	998	0.289	0.290	3b8eA.pdb.gz	Crystal structure of the sodium-potassium pump.
17	PDB:6a69A	0.582	0.630	1.044E-42	911	0.266	0.292	6a69A.pdb.gz
18	PDB:7vpkA	0.730	0.694	8.760E-37	1055	0.203	0.192	7vpkA.pdb.gz	Cryo-EM reveals mechanistic insights into lipid-facilitated polyamine export by human ATP13A2.
19	PDB:7m5xA	0.702	0.701	1.102E-34	1000	0.188	0.188	7m5xA.pdb.gz	Structural mechanisms for gating and ion selectivity of the human polyamine transporter ATP13A2.
20	PDB:7vh5A	0.477	0.571	9.131E-34	804	0.197	0.245	7vh5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IQS8	1540	1041	0.766	0.735	A0A0R4IQS8_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1
2	A8WI68	1233	932	0.598	0.641	A8WI68_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
3	B6CAM1	1551	994	0.752	0.756	B6CAM1_RABIT Calcium-transporting ATPase OS=Oryctolagus cuniculus OX=9986 PE=1 SV=1
4	G5EEK8	1403	1059	0.686	0.647	G5EEK8_CAEEL Calcium-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=sca-1 PE=1 SV=1
5	O14983	1558	1001	0.759	0.757	AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2A1 PE=1 SV=1
6	O23087	872	1054	0.516	0.489	ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA2 PE=1 SV=1
7	O55143	1577	1044	0.767	0.734	AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus OX=10090 GN=Atp2a2 PE=1 SV=2
8	P04191	1550	1001	0.752	0.750	AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus OX=9986 GN=ATP2A1 PE=1 SV=1
9	P11507	1578	1043	0.769	0.736	AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus OX=10116 GN=Atp2a2 PE=1 SV=1
10	P11607	1579	1042	0.769	0.737	AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa OX=9823 GN=ATP2A2 PE=1 SV=1
11	P16615	1575	1042	0.768	0.736	AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2 PE=1 SV=1
12	P18596	1893	999	0.944	0.944	AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus OX=10116 GN=Atp2a3 PE=1 SV=3
13	P22700	1369	1020	0.674	0.660	ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster OX=7227 GN=SERCA PE=1 SV=2
14	P92939	877	1061	0.510	0.480	ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana OX=3702 GN=ECA1 PE=1 SV=2
15	Q03669	1570	1041	0.768	0.737	AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus OX=9031 GN=ATP2A2 PE=2 SV=2
16	Q57Z55	848	1011	0.495	0.490	Q57Z55_TRYB2 Calcium-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.570 PE=3 SV=1
17	Q642Z0	1539	994	0.757	0.761	Q642Z0_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=cb279 PE=1 SV=1
18	Q64518	1903	999	0.949	0.949	AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus OX=10090 GN=Atp2a3 PE=1 SV=4
19	Q64578	1554	994	0.754	0.758	AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus OX=10116 GN=Atp2a1 PE=1 SV=1
20	Q6ZM60	1523	1035	0.761	0.734	Q6ZM60_DANRE Calcium-transporting ATPase OS=Danio rerio OX=7955 GN=SERCA2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	3.1e-16	70.5	Cation transport ATPase (P-type)
2	PF00689 Cation_ATPase_C	3e-44	162.4	Cation transporting ATPase, C-terminus
3	PF00690 Cation_ATPase_N	1.1e-14	65.2	Cation transporter/ATPase, N-terminus
4	PF11304 DUF3106	26	16.7	Protein of unknown function (DUF3106)
5	PF00122 E1-E2_ATPase	3.2e-51	184.9	E1-E2 ATPase
6	PF12710 HAD	4.3	19.3	haloacid dehalogenase-like hydrolase
7	PF00702 Hydrolase	8.2e-17	73.7	haloacid dehalogenase-like hydrolase
8	PF08282 Hydrolase_3	0.005	28.2	haloacid dehalogenase-like hydrolase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000353072

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000350132	0.960	Cardiac phospholamban
2	9606.ENSP00000277541	0.915	Neurogenic locus notch homolog protein 1
3	9606.ENSP00000263388	0.909	Neurogenic locus notch homolog protein 3
4	9606.ENSP00000256646	0.908	Neurogenic locus notch homolog protein 2
5	9606.ENSP00000364163	0.902	Neurogenic locus notch homolog protein 4
6	9606.ENSP00000252825	0.830	Sarcoplasmic reticulum histidine-rich calcium-binding protein
7	9606.ENSP00000340330	0.811	Histone acetyltransferase KAT5
8	9606.ENSP00000349595	0.805	Sarcoplasmic/endoplasmic reticulum calcium ATPase 1
9	9606.ENSP00000440045	0.805	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
10	9606.ENSP00000261523	0.801	Nuclear receptor ROR-alpha
11	9606.ENSP00000478059	0.790	Stromal interaction molecule 1
12	9606.ENSP00000435380	0.775	Sarcolipin
13	9606.ENSP00000328551	0.769	Ras-related protein Rab-28
14	9606.ENSP00000182527	0.764	Translocating chain-associated membrane protein 2
15	9606.ENSP00000373884	0.759	Ryanodine receptor 3
16	9606.ENSP00000352608	0.758	Ryanodine receptor 1
17	9606.ENSP00000355533	0.757	Ryanodine receptor 2
18	9606.ENSP00000306253	0.739	Inositol 1,4,5-trisphosphate receptor type 1
19	9606.ENSP00000363435	0.718	Inositol 1,4,5-trisphosphate receptor type 3
20	9606.ENSP00000417569	0.706	Stromal interaction molecule 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005388	0.999	P-type calcium transporter activity
GO:0005515	0.997	protein binding
GO:0043167	0.632	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0006810	0.989	transport
GO:0009987	0.986	cellular process
GO:0065007	0.981	biological regulation
GO:0006811	0.976	monoatomic ion transport
GO:0050789	0.965	regulation of biological process
GO:0006816	0.941	calcium ion transport
GO:0055080	0.939	monoatomic cation homeostasis
GO:0098771	0.938	inorganic ion homeostasis
GO:0030003	0.929	intracellular monoatomic cation homeostasis
GO:0055085	0.897	transmembrane transport
GO:0034220	0.868	monoatomic ion transmembrane transport
GO:0055074	0.859	calcium ion homeostasis
GO:0006874	0.842	intracellular calcium ion homeostasis
GO:0098662	0.830	inorganic cation transmembrane transport
GO:0098655	0.830	monoatomic cation transmembrane transport
GO:0050794	0.816	regulation of cellular process
GO:0032502	0.806	developmental process
GO:0070588	0.788	calcium ion transmembrane transport
GO:0032501	0.666	multicellular organismal process
GO:0050896	0.649	response to stimulus
GO:0048856	0.468	anatomical structure development
GO:0051716	0.456	cellular response to stimulus
GO:0048518	0.444	positive regulation of biological process
GO:0007154	0.389	cell communication
GO:0051239	0.326	regulation of multicellular organismal process
GO:0023052	0.320	signaling
GO:0007165	0.307	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	0.999	endomembrane system
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0016020	0.998	membrane
GO:0005783	0.990	endoplasmic reticulum
GO:0031090	0.957	organelle membrane
GO:0098588	0.847	bounding membrane of organelle
GO:0005789	0.792	endoplasmic reticulum membrane
GO:0016528	0.659	sarcoplasm
GO:0016529	0.556	sarcoplasmic reticulum
GO:0071944	0.382	cell periphery
GO:0005886	0.371	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:18105	0.999	ATP + Ca(2+)(in) + H2O = ADP + Ca(2+)(out) + H(+) + phosphate
EC:7.2.2.10	0.999	P-type Ca(2+) transporter.

[back to server]