StarFunc result for job id Q93091

User Input

>input (150 residues)
MVLCFPLLLLLLVLWGPVCPLHAWPKRLTKAHWFEIQHIQPSPLQCNRAMSGINNYTQHC
KHQNTFLHDSFQNVAAVCDLLSIVCKNRRHNCHQSSKPVNMTDCRLTSGKYPQCRYSAAA
QYKFFIVACDPPQKSDPPYKLVPVHLDSIL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q93091	1.000	1.000	1.468E-32	150	1.000	1.000	Q93091.pdb.gz	RNAS6_HUMAN Ribonuclease K6 OS=Homo sapiens OX=9606 GN=RNASE6 PE=1 SV=2
2	PDB:6enpA	0.823	0.962	1.346E-25	128	0.847	0.992	6enpA.pdb.gz
3	AFDB:Q9D244	0.868	0.851	6.105E-24	153	0.660	0.647	Q9D244.pdb.gz	RNAS6_MOUSE Ribonuclease K6 OS=Mus musculus OX=10090 GN=Rnase6 PE=1 SV=2
4	AFDB:Q9H1E1	0.868	0.835	2.170E-21	156	0.533	0.513	Q9H1E1.pdb.gz	RNAS7_HUMAN Ribonuclease 7 OS=Homo sapiens OX=9606 GN=RNASE7 PE=1 SV=2
5	AFDB:Q8TDE3	0.879	0.857	1.569E-20	154	0.540	0.526	Q8TDE3.pdb.gz	RNAS8_HUMAN Ribonuclease 8 OS=Homo sapiens OX=9606 GN=RNASE8 PE=1 SV=1
6	AFDB:O18937	0.857	0.816	3.850E-18	158	0.460	0.437	O18937.pdb.gz	RNAS2_AOTTR Non-secretory ribonuclease OS=Aotus trivirgatus OX=9505 GN=RNASE2 PE=1 SV=1
7	AFDB:P47786	0.851	0.809	7.144E-18	158	0.433	0.411	P47786.pdb.gz	RNAS2_SAGOE Non-secretory ribonuclease OS=Saguinus oedipus OX=9490 GN=RNASE2 PE=3 SV=1
8	AFDB:P10153	0.815	0.764	3.792E-17	161	0.467	0.435	P10153.pdb.gz	RNAS2_HUMAN Non-secretory ribonuclease OS=Homo sapiens OX=9606 GN=RNASE2 PE=1 SV=2
9	AFDB:P12724	0.865	0.814	7.964E-17	160	0.433	0.406	P12724.pdb.gz	ECP_HUMAN Eosinophil cationic protein OS=Homo sapiens OX=9606 GN=RNASE3 PE=1 SV=2
10	AFDB:P47783	0.845	0.797	7.964E-17	160	0.453	0.425	P47783.pdb.gz	RNAS2_MACFA Non-secretory ribonuclease OS=Macaca fascicularis OX=9541 GN=RNASE2 PE=1 SV=1
11	PDB:1hi2A	0.801	0.887	5.870E-16	135	0.393	0.437	1hi2A.pdb.gz	Mapping the Ribonucleolytic Active Site of Eosinophil-Derived Neurotoxin (Edn): High Resolution Crystal Structures of Edn Complexes with Adenylic Nucleotide Inhibitors
12	AFDB:P97425	0.801	0.770	7.845E-16	156	0.393	0.378	P97425.pdb.gz	ECP2_MOUSE Eosinophil cationic protein 2 OS=Mus musculus OX=10090 GN=Ear2 PE=2 SV=1
13	PDB:1h1hA	0.814	0.908	1.578E-15	134	0.380	0.425	1h1hA.pdb.gz	The Crystal Structure of Eosinophil Cationic Protein in Complex with 2'5'-Adp at 2.0 A Resolution Reveals the Details of the Ribonucleolytic Active Site
14	PDB:2hkyA	0.748	0.857	4.661E-13	129	0.480	0.558	2hkyA.pdb.gz
15	PDB:3tsrA	0.711	0.851	8.131E-13	124	0.307	0.371	3tsrA.pdb.gz
16	PDB:1rraA	0.691	0.827	1.041E-12	124	0.320	0.387	1rraA.pdb.gz
17	PDB:1kh8A	0.654	0.774	5.527E-12	125	0.327	0.392	1kh8A.pdb.gz	The crystal structure of the cis-proline to glycine variant (P114G) of ribonuclease A.
18	PDB:2e0jA	0.686	0.795	8.010E-12	128	0.293	0.344	2e0jA.pdb.gz
19	PDB:2rnfA	0.660	0.817	1.464E-10	120	0.293	0.367	2rnfA.pdb.gz	The three-dimensional structure of human RNase 4, unliganded and complexed with d(Up), reveals the basis for its uridine selectivity.
20	PDB:11baA	0.583	0.695	4.740E-10	124	0.327	0.395	11baA.pdb.gz	Binding of a substrate analog to a domain swapping protein: X-ray structure of the complex of bovine seminal ribonuclease with uridylyl(2',5')adenosine.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q93091	2.55e-110	311	150	1.000	1.000	RNAS6_HUMAN Ribonuclease K6 OS=Homo sapiens OX=9606 GN=RNASE6 PE=1 SV=2
2	Q9D244	1.79e-63	193	153	0.600	0.588	RNAS6_MOUSE Ribonuclease K6 OS=Mus musculus OX=10090 GN=Rnase6 PE=1 SV=2
3	Q8TDE3	1.09e-46	150	154	0.540	0.526	RNAS8_HUMAN Ribonuclease 8 OS=Homo sapiens OX=9606 GN=RNASE8 PE=1 SV=1
4	Q9H1E1	1.59e-46	150	156	0.487	0.468	RNAS7_HUMAN Ribonuclease 7 OS=Homo sapiens OX=9606 GN=RNASE7 PE=1 SV=2
5	O18937	2.03e-33	117	158	0.413	0.392	RNAS2_AOTTR Non-secretory ribonuclease OS=Aotus trivirgatus OX=9505 GN=RNASE2 PE=1 SV=1
6	P47786	4.68e-32	113	158	0.427	0.405	RNAS2_SAGOE Non-secretory ribonuclease OS=Saguinus oedipus OX=9490 GN=RNASE2 PE=3 SV=1
7	P47784	2.22e-30	109	161	0.420	0.391	RNAS2_PONPY Non-secretory ribonuclease OS=Pongo pygmaeus OX=9600 GN=RNASE2 PE=1 SV=1
8	P47783	3.58e-29	106	160	0.407	0.381	RNAS2_MACFA Non-secretory ribonuclease OS=Macaca fascicularis OX=9541 GN=RNASE2 PE=1 SV=1
9	P10153	4.32e-29	106	161	0.413	0.385	RNAS2_HUMAN Non-secretory ribonuclease OS=Homo sapiens OX=9606 GN=RNASE2 PE=1 SV=2
10	P12724	8.00e-28	102	160	0.393	0.369	ECP_HUMAN Eosinophil cationic protein OS=Homo sapiens OX=9606 GN=RNASE3 PE=1 SV=2
11	Q923L6	1.67e-27	102	156	0.393	0.378	Q923L6_MOUSE Eosinophil-associated ribonuclease 10 OS=Mus musculus OX=10090 GN=Ear10 PE=3 SV=1
12	P97425	6.07e-26	97.8	156	0.380	0.365	ECP2_MOUSE Eosinophil cationic protein 2 OS=Mus musculus OX=10090 GN=Ear2 PE=2 SV=1
13	P97426	2.01e-25	96.7	155	0.380	0.368	ECP1_MOUSE Eosinophil cationic protein 1 OS=Mus musculus OX=10090 GN=Ear1 PE=2 SV=1
14	Q9R126	2.01e-25	96.7	155	0.387	0.374	Q9R126_MOUSE Eosinophil-associated ribonuclease 7 (Fragment) OS=Mus musculus OX=10090 GN=Ear7 PE=3 SV=1
15	Q923L7	5.66e-25	95.5	155	0.373	0.361	Q923L7_MOUSE Ear6 protein OS=Mus musculus OX=10090 GN=Ear6 PE=1 SV=1
16	P00684	3.81e-23	90.5	152	0.360	0.355	RNS1B_RAT Ribonuclease pancreatic beta-type OS=Rattus norvegicus OX=10116 GN=Rnase1 PE=1 SV=1
17	P00683	1.10e-20	84.3	149	0.333	0.336	RNAS1_MOUSE Ribonuclease pancreatic OS=Mus musculus OX=10090 GN=Rnase1 PE=1 SV=2
18	P61823	1.04e-19	81.6	150	0.347	0.347	RNAS1_BOVIN Ribonuclease pancreatic OS=Bos taurus OX=9913 GN=RNASE1 PE=1 SV=1
19	P07998	4.54e-17	75.1	156	0.300	0.288	RNAS1_HUMAN Ribonuclease pancreatic OS=Homo sapiens OX=9606 GN=RNASE1 PE=1 SV=4
20	P00669	3.28e-16	72.8	150	0.320	0.320	RNS_BOVIN Seminal ribonuclease OS=Bos taurus OX=9913 GN=SRN PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00074 RnaseA	1.4e-37	140.2	Pancreatic ribonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302046

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426455	0.789	Ribonuclease T2
2	9606.ENSP00000369286	0.787	Lymphocyte antigen 86
3	9606.ENSP00000289902	0.737	High affinity immunoglobulin epsilon receptor subunit gamma
4	9606.ENSP00000262629	0.665	TYRO protein tyrosine kinase-binding protein
5	9606.ENSP00000294507	0.663	Lysosomal-associated transmembrane protein 5
6	9606.ENSP00000379111	0.655	Interleukin-4 receptor subunit alpha
7	9606.ENSP00000451318	0.647	Ribonuclease, RNase A family, 11 (non-active)
8	9606.ENSP00000476537	0.647	Ribonuclease A family member 11
9	9606.ENSP00000372410	0.641	Probable inactive ribonuclease-like protein 13
10	9606.ENSP00000392770	0.614	Membrane-spanning 4-domains subfamily A member 6A
11	9606.ENSP00000356530	0.605	2-5A-dependent ribonuclease
12	9606.ENSP00000271324	0.575	Leukocyte surface antigen CD53
13	9606.ENSP00000333779	0.560	Protein EVI2B
14	9606.ENSP00000384053	0.550	Cytokine receptor common subunit beta
15	9606.ENSP00000338648	0.543	Membrane-spanning 4-domains subfamily A member 4A
16	9606.ENSP00000367851	0.543	Cytochrome b-245 heavy chain
17	9606.ENSP00000357906	0.535	Tumor necrosis factor alpha-induced protein 8-like protein 2
18	9606.ENSP00000046794	0.532	Lymphocyte cytosolic protein 2
19	9606.ENSP00000357123	0.532	Myeloid cell nuclear differentiation antigen
20	9606.ENSP00000225371	0.531	Eosinophil peroxidase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004540	1.000	ribonuclease activity
GO:0005488	0.988	binding
GO:0005515	0.905	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.987	cellular process
GO:0006955	0.986	immune response
GO:0006952	0.951	defense response
GO:0006959	0.941	humoral immune response
GO:0098542	0.937	defense response to other organism
GO:0045087	0.931	innate immune response
GO:0019730	0.923	antimicrobial humoral response
GO:0050830	0.913	defense response to Gram-positive bacterium
GO:0019731	0.890	antibacterial humoral response
GO:0071704	0.679	organic substance metabolic process
GO:0061844	0.632	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0050829	0.590	defense response to Gram-negative bacterium
GO:0044237	0.561	cellular metabolic process
GO:0050789	0.368	regulation of biological process
GO:0043170	0.356	macromolecule metabolic process
GO:0044238	0.353	primary metabolic process
GO:0006807	0.320	nitrogen compound metabolic process
GO:1901360	0.306	organic cyclic compound metabolic process
GO:0006725	0.306	cellular aromatic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005615	0.999	extracellular space
GO:0043227	0.969	membrane-bounded organelle
GO:0043229	0.957	intracellular organelle
GO:0043231	0.944	intracellular membrane-bounded organelle
GO:0031410	0.838	cytoplasmic vesicle
GO:0005886	0.484	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	1.000	Acting on ester bonds.

[back to server]