StarFunc result for job id Q93097

User Input

>input (391 residues)
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q93097	1.000	1.000	5.523E-73	391	1.000	1.000	Q93097.pdb.gz	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
2	AFDB:B0S7E3	0.823	0.813	5.492E-59	396	0.719	0.710	B0S7E3.pdb.gz
3	AFDB:Q98SN7	0.809	0.821	6.801E-58	385	0.765	0.777	Q98SN7.pdb.gz	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
4	AFDB:B3DFK5	0.841	0.850	5.202E-57	387	0.693	0.700	B3DFK5.pdb.gz
5	AFDB:P09544	0.794	0.860	1.515E-51	360	0.619	0.672	P09544.pdb.gz	WNT2_HUMAN Protein Wnt-2 OS=Homo sapiens OX=9606 GN=WNT2 PE=2 SV=1
6	AFDB:Q92048	0.794	0.885	1.515E-51	350	0.535	0.597	Q92048.pdb.gz	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
7	AFDB:P49337	0.748	0.831	3.954E-40	351	0.442	0.493	P49337.pdb.gz	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
8	AFDB:B1WBR9	0.742	0.779	1.093E-39	372	0.458	0.481	B1WBR9.pdb.gz	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
9	AFDB:P22725	0.735	0.756	1.284E-39	380	0.450	0.463	P22725.pdb.gz	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
10	AFDB:P31286	0.744	0.765	1.770E-39	380	0.453	0.466	P31286.pdb.gz	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2
11	PDB:6ahyB	0.703	0.867	8.115E-31	313	0.373	0.466	6ahyB.pdb.gz
12	PDB:4f0aB	0.644	0.843	1.460E-25	294	0.297	0.395	4f0aB.pdb.gz	Structural basis of Wnt recognition by Frizzled.
13	PDB:6sb3A	0.059	0.040	1.370	604	0.018	0.012	6sb3A.pdb.gz
14	PDB:3b07B	0.077	0.103	1.609	270	0.008	0.011	3b07B.pdb.gz
15	PDB:7pzyx	0.053	0.103	1.790	172	0.003	0.006	7pzyx.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
16	PDB:1i9gA	0.097	0.128	1.889	264	0.028	0.042	1i9gA.pdb.gz	Crystal structure of Rv2118c: an AdoMet-dependent methyltransferase from Mycobacterium tuberculosis H37Rv.
17	PDB:5apnP	0.057	0.093	1.993	183	0.013	0.027	5apnP.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
18	PDB:4v8mBR	0.050	0.089	2.469	154	0.023	0.058	4v8mBR.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:8a1dA	0.068	0.055	2.604	533	0.020	0.015	8a1dA.pdb.gz	Cryo-EM structures of perforin-2 in isolation and assembled on a membrane suggest a mechanism for pore formation.
20	PDB:4v8mA2	0.089	0.141	2.899	187	0.036	0.075	4v8mA2.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O70283	0.0	727	389	0.954	0.959	WNT2B_MOUSE Protein Wnt-2b OS=Mus musculus OX=10090 GN=Wnt2b PE=2 SV=3
2	P09544	0.0	521	360	0.604	0.656	WNT2_HUMAN Protein Wnt-2 OS=Homo sapiens OX=9606 GN=WNT2 PE=2 SV=1
3	P21552	0.0	527	360	0.614	0.667	WNT2_MOUSE Protein Wnt-2 OS=Mus musculus OX=10090 GN=Wnt2 PE=2 SV=2
4	Q1L130	0.0	590	396	0.721	0.712	Q1L130_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2bb PE=2 SV=1
5	Q8AY89	0.0	568	387	0.657	0.664	Q8AY89_DANRE Protein Wnt OS=Danio rerio OX=7955 GN=wnt2b PE=2 SV=1
6	Q93097	0.0	803	391	1.000	1.000	WNT2B_HUMAN Protein Wnt-2b OS=Homo sapiens OX=9606 GN=WNT2B PE=1 SV=2
7	Q98SN7	0.0	630	385	0.757	0.769	WNT2B_CHICK Protein Wnt-2b OS=Gallus gallus OX=9031 GN=WNT2B PE=1 SV=1
8	Q92048	1.65e-171	484	350	0.535	0.597	WNT2_DANRE Protein Wnt-2 OS=Danio rerio OX=7955 GN=wnt2 PE=2 SV=1
9	Q3L257	6.20e-129	372	245	0.435	0.694	Q3L257_CHICK Protein Wnt (Fragment) OS=Gallus gallus OX=9031 GN=WNT2 PE=2 SV=1
10	P22725	5.58e-120	354	380	0.460	0.474	WNT5A_MOUSE Protein Wnt-5a OS=Mus musculus OX=10090 GN=Wnt5a PE=1 SV=2
11	Q9QXQ7	6.22e-120	354	380	0.460	0.474	WNT5A_RAT Protein Wnt-5a OS=Rattus norvegicus OX=10116 GN=Wnt5a PE=2 SV=2
12	P41221	8.72e-120	354	380	0.450	0.463	WNT5A_HUMAN Protein Wnt-5a OS=Homo sapiens OX=9606 GN=WNT5A PE=1 SV=2
13	Q3L255	1.57e-119	352	359	0.448	0.487	Q3L255_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT5b PE=2 SV=1
14	P22726	2.56e-119	352	359	0.445	0.485	WNT5B_MOUSE Protein Wnt-5b OS=Mus musculus OX=10090 GN=Wnt5b PE=1 SV=2
15	A0A0G2K3B7	4.54e-119	351	353	0.453	0.501	A0A0G2K3B7_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt7b PE=3 SV=1
16	B1WBR9	5.96e-119	352	372	0.448	0.470	B1WBR9_RAT Protein Wnt OS=Rattus norvegicus OX=10116 GN=Wnt5b PE=3 SV=1
17	P49337	9.40e-119	350	351	0.440	0.490	WNT4_CHICK Protein Wnt-4 OS=Gallus gallus OX=9031 GN=WNT4 PE=1 SV=1
18	Q9DEB8	2.11e-117	347	349	0.432	0.484	Q9DEB8_CHICK Protein Wnt OS=Gallus gallus OX=9031 GN=WNT7A PE=2 SV=1
19	Q3L254	5.16e-117	346	349	0.430	0.481	WNT7B_CHICK Protein Wnt-7b OS=Gallus gallus OX=9031 GN=WNT7B PE=2 SV=1
20	P31286	5.35e-117	347	380	0.425	0.437	WNT5A_XENLA Protein Wnt-5a OS=Xenopus laevis OX=8355 GN=wnt5a PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00110 wnt	1.5e-119	410.7	wnt family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358698

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000322304	0.962	Protein-serine O-palmitoleoyltransferase porcupine
2	9606.ENSP00000434034	0.937	Frizzled-4
3	9606.ENSP00000286201	0.933	Frizzled-7
4	9606.ENSP00000272164	0.922	Protein Wnt-9a
5	9606.ENSP00000290015	0.920	Protein Wnt-9b
6	9606.ENSP00000340677	0.919	Protein Wnt-8b
7	9606.ENSP00000426653	0.919	Protein Wnt-8a
8	9606.ENSP00000261349	0.911	Low-density lipoprotein receptor-related protein 6
9	9606.ENSP00000265441	0.910	Protein Wnt-2
10	9606.ENSP00000294304	0.910	Low-density lipoprotein receptor-related protein 5
11	9606.ENSP00000293549	0.909	Proto-oncogene Wnt-1
12	9606.ENSP00000301061	0.909	Protein Wnt-10b
13	9606.ENSP00000325526	0.908	Protein Wnt-11
14	9606.ENSP00000258411	0.907	Protein Wnt-10a
15	9606.ENSP00000222462	0.906	Protein Wnt-16
16	9606.ENSP00000233948	0.906	Protein Wnt-6
17	9606.ENSP00000284523	0.906	Protein Wnt-3a
18	9606.ENSP00000359305	0.906	Transmembrane emp24 domain-containing protein 5
19	9606.ENSP00000225512	0.905	Proto-oncogene Wnt-3
20	9606.ENSP00000264634	0.905	Protein Wnt-5a

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	1.000	signaling receptor binding
GO:0030545	0.975	signaling receptor regulator activity
GO:0048018	0.971	receptor ligand activity
GO:0005109	0.896	frizzled binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.999	multicellular organismal process
GO:0048856	0.999	anatomical structure development
GO:0050794	0.999	regulation of cellular process
GO:0051716	0.998	cellular response to stimulus
GO:0023052	0.997	signaling
GO:0007154	0.997	cell communication
GO:0007275	0.993	multicellular organism development
GO:0060070	0.987	canonical Wnt signaling pathway
GO:0048731	0.977	system development
GO:0048518	0.941	positive regulation of biological process
GO:0048513	0.940	animal organ development
GO:0019222	0.860	regulation of metabolic process
GO:0048522	0.845	positive regulation of cellular process
GO:0060255	0.811	regulation of macromolecule metabolic process
GO:0009653	0.707	anatomical structure morphogenesis
GO:0080090	0.705	regulation of primary metabolic process
GO:0060322	0.704	head development
GO:0010468	0.697	regulation of gene expression
GO:0009893	0.677	positive regulation of metabolic process
GO:0009888	0.675	tissue development
GO:0031323	0.674	regulation of cellular metabolic process
GO:0010604	0.670	positive regulation of macromolecule metabolic process
GO:0007399	0.668	nervous system development
GO:0030154	0.665	cell differentiation
GO:0051171	0.663	regulation of nitrogen compound metabolic process
GO:0048519	0.646	negative regulation of biological process
GO:0007417	0.590	central nervous system development
GO:0048523	0.573	negative regulation of cellular process
GO:0009889	0.480	regulation of biosynthetic process
GO:0050793	0.465	regulation of developmental process
GO:0051239	0.455	regulation of multicellular organismal process
GO:0019219	0.447	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.438	regulation of cellular biosynthetic process
GO:0023051	0.433	regulation of signaling
GO:0010646	0.433	regulation of cell communication
GO:0010556	0.433	regulation of macromolecule biosynthetic process
GO:0051252	0.432	regulation of RNA metabolic process
GO:0048583	0.431	regulation of response to stimulus
GO:0051173	0.401	positive regulation of nitrogen compound metabolic process
GO:0006355	0.396	regulation of DNA-templated transcription
GO:0009966	0.395	regulation of signal transduction
GO:0031325	0.376	positive regulation of cellular metabolic process
GO:0009891	0.312	positive regulation of biosynthetic process
GO:0042127	0.309	regulation of cell population proliferation
GO:0031328	0.301	positive regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.998	extracellular region
GO:0005737	0.997	cytoplasm
GO:0012505	0.996	endomembrane system
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0070013	0.995	intracellular organelle lumen
GO:0071944	0.992	cell periphery
GO:0016020	0.949	membrane
GO:0005886	0.931	plasma membrane
GO:0005615	0.866	extracellular space
GO:0030312	0.608	external encapsulating structure
GO:0031982	0.599	vesicle
GO:0031012	0.484	extracellular matrix
GO:0031410	0.417	cytoplasmic vesicle
GO:0031090	0.385	organelle membrane
GO:0005783	0.375	endoplasmic reticulum
GO:0031981	0.341	nuclear lumen
GO:0062023	0.320	collagen-containing extracellular matrix
GO:1903561	0.305	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]