StarFunc result for job id Q93100

User Input

>input (1093 residues)
MAGAAGLTAEVSWKVLERRARTKRSGSVYEPLKSINLPRPDNETLWDKLDHYYRIVKSTL
LLYQSPTTGLFPTKTCGGDQKAKIQDSLYCAAGAWALALAYRRIDDDKGRTHELEHSAIK
CMRGILYCYMRQADKVQQFKQDPRPTTCLHSVFNVHTGDELLSYEEYGHLQINAVSLYLL
YLVEMISSGLQIIYNTDEVSFIQNLVFCVERVYRVPDFGVWERGSKYNNGSTELHSSSVG
LAKAALEAINGFNLFGNQGCSWSVIFVDLDAHNRNRQTLCSLLPRESRSHNTDAALLPCI
SYPAFALDDEVLFSQTLDKVVRKLKGKYGFKRFLRDGYRTSLEDPNRCYYKPAEIKLFDG
IECEFPIFFLYMMIDGVFRGNPKQVQEYQDLLTPVLHHTTEGYPVVPKYYYVPADFVEYE
KNNPGSQKRFPSNCGRDGKLFLWGQALYIIAKLLADELISPKDIDPVQRYVPLKDQRNVS
MRFSNQGPLENDLVVHVALIAESQRLQVFLNTYGIQTQTPQQVEPIQIWPQQELVKAYLQ
LGINEKLGLSGRPDRPIGCLGTSKIYRILGKTVVCYPIIFDLSDFYMSQDVFLLIDDIKN
ALQFIKQYWKMHGRPLFLVLIREDNIRGSRFNPILDMLAALKKGIIGGVKVHVDRLQTLI
SGAVVEQLDFLRISDTEELPEFKSFEELEPPKHSKVKRQSSTPSAPELGQQPDVNISEWK
DKPTHEILQKLNDCSCLASQAILLGILLKREGPNFITKEGTVSDHIERVYRRAGSQKLWL
AVRYGAAFTQKFSSSIAPHITTFLVHGKQVTLGAFGHEEEVISNPLSPRVIQNIIYYKCN
THDEREAVIQQELVIHIGWIISNNPELFSGMLKIRIGWIIHAMEYELQIRGGDKPALDLY
QLSPSEVKQLLLDILQPQQNGRCWLNRRQIDGSLNRTPTGFYDRVWQILERTPNGIIVAG
KHLPQQPTLSDMTMYEMNFSLLVEDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQD
KVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEG
EVKPNNDDPCLIS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5RKH5	0.939	0.933	0.000	1100	0.883	0.877	Q5RKH5.pdb.gz	Q5RKH5_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
2	AFDB:Q93100	1.000	1.000	0.000	1093	1.000	1.000	Q93100.pdb.gz	KPBB_HUMAN Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3
3	AFDB:P46019	0.848	0.752	1.164E-81	1235	0.356	0.315	P46019.pdb.gz	KPB2_HUMAN Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1
4	AFDB:Q64649	0.842	0.743	1.775E-79	1242	0.340	0.300	Q64649.pdb.gz	KPB1_RAT Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Phka1 PE=1 SV=2
5	PDB:6frvA	0.233	0.479	1.388E-5	467	0.062	0.146	6frvA.pdb.gz	Structural insight into industrially relevant glucoamylases: flexible positions of starch-binding domains.
6	AFDB:Q9FXA8	0.239	0.387	3.558E-5	616	0.063	0.112	Q9FXA8.pdb.gz	INVA_ARATH Alkaline/neutral invertase A, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=INVA PE=1 SV=1
7	AFDB:Q69T31	0.235	0.408	1.573E-4	562	0.044	0.085	Q69T31.pdb.gz	CINV1_ORYSJ Cytosolic invertase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CINV1 PE=1 SV=1
8	PDB:6ttjC	0.241	0.525	1.605E-4	441	0.051	0.127	6ttjC.pdb.gz
9	AFDB:Q9FK88	0.233	0.377	3.938E-4	617	0.057	0.100	Q9FK88.pdb.gz	INVE_ARATH Alkaline/neutral invertase E, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=INVE PE=1 SV=1
10	PDB:3qryB	0.229	0.502	3.135E-3	426	0.049	0.127	3qryB.pdb.gz	Analysis of a New Family of Widely Distributed Metal-independent {alpha}-Mannosidases Provides Unique Insight into the Processing of N-Linked Glycans.
11	PDB:2rgkA	0.179	0.396	1.386E-2	409	0.048	0.127	2rgkA.pdb.gz
12	AFDB:Q54JR2	0.072	0.061	2.103E-2	1412	0.108	0.084	Q54JR2.pdb.gz	ABCC3_DICDI ABC transporter C family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcC3 PE=3 SV=1
13	PDB:1dl2A	0.169	0.298	2.789E-2	510	0.049	0.106	1dl2A.pdb.gz
14	PDB:5nugA	0.070	0.045	6.400E-2	2920	0.094	0.035	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
15	AFDB:Q5TIQ4	0.172	0.191	9.295E-2	938	0.059	0.069	Q5TIQ4.pdb.gz	Q5TIQ4_ACETH 1,4-beta-glucanase OS=Acetivibrio thermocellus OX=1515 GN=celY PE=4 SV=1
16	AFDB:B8K1W2	0.066	0.059	1.319E-1	1325	0.118	0.097	B8K1W2.pdb.gz	ABCBB_CANLF Bile salt export pump OS=Canis lupus familiaris OX=9615 GN=Abcb11e PE=1 SV=1
17	PDB:3qxqA	0.172	0.441	1.603E-1	338	0.038	0.124	3qxqA.pdb.gz	Apo- and cellopentaose-bound structures of the bacterial cellulose synthase subunit BcsZ.
18	PDB:1ut9A	0.183	0.291	3.677E-1	605	0.045	0.081	1ut9A.pdb.gz
19	PDB:2bb5A	0.152	0.323	3.842E-1	409	0.045	0.120	2bb5A.pdb.gz	Structural basis for mammalian vitamin B12 transport by transcobalamin.
20	PDB:6trhC	0.140	0.316	4.380E-1	385	0.045	0.127	6trhC.pdb.gz	Structural analysis of the reducing-end xylose-releasing exo-oligoxylanase Rex8A from Paenibacillus barcinonensis BP-23 deciphers its molecular specificity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K9C8	0.0	2081	1085	0.919	0.925	A0A0G2K9C8_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
2	A0A8I5Y5Q0	0.0	2078	1079	0.917	0.929	A0A8I5Y5Q0_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
3	A0A8I5ZXC2	0.0	1972	1034	0.871	0.921	A0A8I5ZXC2_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
4	A0A8J8YFM3	0.0	2116	1093	0.934	0.934	A0A8J8YFM3_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
5	Q5RKH5	0.0	2007	1100	0.886	0.880	Q5RKH5_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phkb PE=1 SV=1
6	Q93100	0.0	2266	1093	1.000	1.000	KPBB_HUMAN Phosphorylase b kinase regulatory subunit beta OS=Homo sapiens OX=9606 GN=PHKB PE=1 SV=3
7	P46020	2.65e-157	501	1223	0.242	0.216	KPB1_HUMAN Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1 PE=1 SV=2
8	Q64649	4.28e-154	493	1242	0.239	0.210	KPB1_RAT Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Rattus norvegicus OX=10116 GN=Phka1 PE=1 SV=2
9	A0A8I6A710	6.53e-153	488	1190	0.242	0.222	A0A8I6A710_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=AABR07037995.1 PE=1 SV=1
10	A0A8I5ZWF0	8.75e-153	489	1217	0.242	0.217	A0A8I5ZWF0_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phka2 PE=1 SV=1
11	A0A8I5ZLG9	1.12e-152	488	1207	0.242	0.219	A0A8I5ZLG9_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=Phka2 PE=1 SV=1
12	P46019	1.51e-149	481	1235	0.242	0.215	KPB2_HUMAN Phosphorylase b kinase regulatory subunit alpha, liver isoform OS=Homo sapiens OX=9606 GN=PHKA2 PE=1 SV=1
13	F1M1C9	1.73e-148	456	538	0.220	0.446	F1M1C9_RAT Phosphorylase b kinase regulatory subunit OS=Rattus norvegicus OX=10116 GN=AABR07037995.1 PE=1 SV=4
14	Q6NVF4	3.7	34.3	1074	0.027	0.028	HELB_MOUSE DNA helicase B OS=Mus musculus OX=10090 GN=Helb PE=1 SV=2
15	Q9UNE2	8.9	32.3	315	0.020	0.070	RPH3L_HUMAN Rab effector Noc2 OS=Homo sapiens OX=9606 GN=RPH3AL PE=1 SV=1
16	Q9H089	9.4	32.7	658	0.026	0.043	LSG1_HUMAN Large subunit GTPase 1 homolog OS=Homo sapiens OX=9606 GN=LSG1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00723 Glyco_hydro_15	6.3e-107	369.8	Glycosyl hydrolases family 15
2	PF19292 KPBB_C	1.3e-25	101.6	Phosphorylase b kinase C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000313504

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000455607	0.995	Phosphorylase b kinase gamma catalytic chain, liver/testis isoform
2	9606.ENSP00000445440	0.977	Phosphorylase b kinase gamma catalytic chain, skeletal muscle/heart isoform
3	9606.ENSP00000216392	0.959	Glycogen phosphorylase, liver form
4	9606.ENSP00000164139	0.958	Glycogen phosphorylase, muscle form
5	9606.ENSP00000216962	0.950	Glycogen phosphorylase, brain form
6	9606.ENSP00000369274	0.929	Phosphorylase b kinase regulatory subunit alpha, liver isoform
7	9606.ENSP00000349467	0.905	Calmodulin-1
8	9606.ENSP00000362643	0.902	Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform
9	9606.ENSP00000272298	0.884	Calmodulin 2 (phosphorylase kinase, delta)
10	9606.ENSP00000291295	0.825	Calmodulin 3 (phosphorylase kinase, delta)
11	9606.ENSP00000304643	0.822	Calmodulin-like protein 6
12	9606.ENSP00000315299	0.822	Calmodulin-like protein 3
13	9606.ENSP00000369689	0.822	Calmodulin-like protein 5
14	9606.ENSP00000419081	0.822	Calmodulin-like protein 4
15	9606.ENSP00000378177	0.749	Cell migration-inducing and hyaluronan-binding protein
16	9606.ENSP00000397133	0.730	5'-AMP-activated protein kinase subunit gamma-3
17	9606.ENSP00000412763	0.714	MAM and LDL-receptor class A domain-containing protein 1
18	9606.ENSP00000308318	0.713	Protein phosphatase 1 regulatory subunit 3B
19	9606.ENSP00000478310	0.705	Signal peptidase complex subunit 1
20	9606.ENSP00000353732	0.703	CAP-Gly domain-containing linker protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.975	catalytic activity
GO:0016740	0.828	transferase activity
GO:0016772	0.356	transferase activity, transferring phosphorus-containing groups

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	1.000	organic substance metabolic process
GO:0009987	0.999	cellular process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.990	cellular metabolic process
GO:0043170	0.944	macromolecule metabolic process
GO:0006807	0.843	nitrogen compound metabolic process
GO:1901564	0.811	organonitrogen compound metabolic process
GO:0006796	0.545	phosphate-containing compound metabolic process
GO:0019538	0.541	protein metabolic process
GO:0036211	0.457	protein modification process
GO:0006091	0.401	generation of precursor metabolites and energy
GO:0006468	0.397	protein phosphorylation
GO:0005975	0.381	carbohydrate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:1902494	0.996	catalytic complex
GO:1902554	0.977	serine/threonine protein kinase complex
GO:0005829	0.969	cytosol
GO:0043229	0.552	intracellular organelle
GO:0043227	0.538	membrane-bounded organelle
GO:0043231	0.508	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.828	Transferases.
EC:2.7.-.-	0.356	Transferring phosphorus-containing groups.

[back to server]