StarFunc result for job id Q95460

User Input

>input (341 residues)
MGELMAFLLPLIIVLMVKHSDSRTHSLRYFRLGVSDPIHGVPEFISVGYVDSHPITTYDS
VTRQKEPRAPWMAENLAPDHWERYTQLLRGWQQMFKVELKRLQRHYNHSGSHTYQRMIGC
ELLEDGSTTGFLQYAYDGQDFLIFNKDTLSWLAVDNVAHTIKQAWEANQHELLYQKNWLE
EECIAWLKRFLEYGKDTLQRTEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNG
EEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
VMKAVSGSIVLVIVLAGVGVLVWRRRPREQNGAIYLPTPDR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q95460	1.000	1.000	3.290E-66	341	1.000	1.000	Q95460.pdb.gz	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
2	AFDB:Q8HWB0	0.773	0.773	8.502E-53	341	0.751	0.751	Q8HWB0.pdb.gz	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
3	AFDB:A0ZXM3	0.726	0.695	1.447E-35	357	0.375	0.359	A0ZXM3.pdb.gz	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
4	AFDB:U3PTD3	0.738	0.732	3.094E-35	344	0.375	0.372	U3PTD3.pdb.gz	U3PTD3_CHICK MHC class I alpha OS=Gallus gallus OX=9031 PE=2 SV=1
5	AFDB:Q30201	0.693	0.680	1.148E-32	348	0.340	0.333	Q30201.pdb.gz	HFE_HUMAN Hereditary hemochromatosis protein OS=Homo sapiens OX=9606 GN=HFE PE=1 SV=1
6	AFDB:P01902	0.740	0.690	1.279E-32	368	0.375	0.348	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
7	AFDB:Q6MGB8	0.738	0.690	1.426E-32	366	0.393	0.366	Q6MGB8.pdb.gz	Q6MGB8_RAT RT1 class I, A2 OS=Rattus norvegicus OX=10116 GN=RT1-A2 PE=2 SV=1
8	AFDB:P01900	0.728	0.682	1.590E-32	365	0.390	0.364	P01900.pdb.gz	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
9	AFDB:P01889	0.729	0.689	2.888E-32	362	0.358	0.337	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
10	AFDB:Q8HWF3	0.717	0.700	8.551E-32	350	0.302	0.294	Q8HWF3.pdb.gz
11	PDB:5j6hA	0.724	0.888	2.509E-29	275	0.355	0.440	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
12	PDB:6e1iA	0.723	0.639	1.677E-28	389	0.334	0.293	6e1iA.pdb.gz
13	PDB:3es6A	0.646	0.773	2.530E-27	277	0.290	0.357	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
14	PDB:6d7gA	0.713	0.635	1.517E-26	386	0.331	0.293	6d7gA.pdb.gz
15	PDB:3nwmA	0.720	0.642	9.604E-26	384	0.334	0.297	3nwmA.pdb.gz
16	PDB:6mp0A	0.723	0.639	1.565E-25	388	0.334	0.294	6mp0A.pdb.gz
17	PDB:2qriA	0.726	0.626	2.007E-24	398	0.331	0.284	2qriA.pdb.gz
18	PDB:6fgbA	0.631	0.789	8.042E-23	265	0.235	0.302	6fgbA.pdb.gz
19	PDB:1cd1A	0.612	0.741	5.639E-17	273	0.158	0.198	1cd1A.pdb.gz
20	PDB:3ov6A	0.622	0.571	5.953E-17	376	0.188	0.170	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8HWB0	0.0	541	341	0.742	0.742	HMR1_MOUSE Major histocompatibility complex class I-related gene protein OS=Mus musculus OX=10090 GN=Mr1 PE=1 SV=2
2	Q95460	0.0	713	341	1.000	1.000	HMR1_HUMAN Major histocompatibility complex class I-related gene protein OS=Homo sapiens OX=9606 GN=MR1 PE=1 SV=1
3	P04439	2.25e-73	233	365	0.370	0.345	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
4	Q5RIP0	5.52e-71	227	366	0.361	0.336	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
5	Q6QMF2	8.89e-71	225	331	0.358	0.369	Q6QMF2_MOUSE MHC class I antigen (Fragment) OS=Mus musculus OX=10090 GN=H2-Bl PE=2 SV=1
6	V9HVU9	8.89e-71	225	331	0.358	0.369	V9HVU9_MOUSE MHC class I antigen (Fragment) OS=Mus musculus OX=10090 GN=H2-Bl PE=2 SV=1
7	Q4VCN9	1.47e-70	225	349	0.355	0.347	Q4VCN9_MOUSE MHC class I antigen splice variant Bl.1 OS=Mus musculus OX=10090 GN=H2-Bl PE=2 SV=1
8	O19440	1.76e-70	225	349	0.355	0.347	O19440_MOUSE MHC class I antigen OS=Mus musculus OX=10090 GN=H2-Bl PE=2 SV=1
9	Q5SUL5	2.64e-70	225	365	0.364	0.340	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
10	Q95601	2.71e-70	224	355	0.337	0.324	Q95601_CHICK MHC class I alpha chain 2 OS=Gallus gallus OX=9031 GN=BFIV21 PE=1 SV=1
11	A0ZXM3	2.87e-70	224	357	0.337	0.322	A0ZXM3_CHICK MHC class I molecule OS=Gallus gallus OX=9031 GN=BF2 PE=1 SV=1
12	Q7YQB1	6.93e-70	224	366	0.352	0.328	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
13	P01898	1.51e-69	222	325	0.358	0.375	HA10_MOUSE H-2 class I histocompatibility antigen, Q10 alpha chain OS=Mus musculus OX=10090 GN=H2-Q10 PE=1 SV=3
14	P04223	1.84e-69	223	369	0.375	0.347	HA1K_MOUSE H-2 class I histocompatibility antigen, K-K alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
15	P01900	2.25e-69	223	365	0.370	0.345	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
16	P01889	2.37e-69	223	362	0.340	0.320	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
17	P01893	4.29e-69	222	362	0.370	0.348	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
18	Q6MGB8	7.88e-69	221	366	0.361	0.336	Q6MGB8_RAT RT1 class I, A2 OS=Rattus norvegicus OX=10116 GN=RT1-A2 PE=2 SV=1
19	P01897	1.79e-68	220	362	0.378	0.356	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
20	P01899	1.85e-68	220	362	0.378	0.356	HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.8e-11	54.9	Immunoglobulin C1-set domain
2	PF13927 Ig_3	38	16.3	Immunoglobulin domain
3	PF17870 Insulin_TMD	5.3e+02	12.1	Insulin receptor trans-membrane segment
4	PF00129 MHC_I	1.7e-53	192.4	Class I Histocompatibility antigen, domains alpha 1 and 2
5	PF16497 MHC_I_3	5.4e-07	40.8	MHC-I family domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000477563

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452780	0.979	Beta-2-microglobulin
2	9606.ENSP00000365817	0.690	HLA class I histocompatibility antigen, alpha chain E
3	9606.ENSP00000363976	0.669	HLA class II histocompatibility antigen, DM alpha chain
4	9606.ENSP00000378786	0.659	HLA class II histocompatibility antigen, DR alpha chain
5	9606.ENSP00000365402	0.646	HLA class I histocompatibility antigen, Cw-7 alpha chain
6	9606.ENSP00000259951	0.592	HLA class I histocompatibility antigen, alpha chain F
7	9606.ENSP00000399168	0.571	HLA class I histocompatibility antigen, B-7 alpha chain
8	9606.ENSP00000339398	0.567	Major histocompatibility complex, class II, DQ alpha 1
9	9606.ENSP00000412927	0.567	HLA class I histocompatibility antigen, alpha chain G
10	9606.ENSP00000364076	0.565	HLA class II histocompatibility antigen, DQ alpha 2 chain
11	9606.ENSP00000364080	0.563	HLA class II histocompatibility antigen, DQ beta 1 chain
12	9606.ENSP00000379873	0.560	HLA class I histocompatibility antigen, A-3 alpha chain
13	9606.ENSP00000390431	0.558	Major histocompatibility complex, class II, DQ beta 2
14	9606.ENSP00000229829	0.556	HLA class II histocompatibility antigen, DO alpha chain
15	9606.ENSP00000363345	0.556	Thymic stromal cotransporter homolog
16	9606.ENSP00000398890	0.555	HLA class II histocompatibility antigen, DM beta chain
17	9606.ENSP00000390020	0.551	HLA class II histocompatibility antigen, DO beta chain
18	9606.ENSP00000393566	0.549	HLA class II histocompatibility antigen, DP alpha 1 chain
19	9606.ENSP00000353099	0.547	HLA class II histocompatibility antigen, DRB1-15 beta chain
20	9606.ENSP00000364114	0.547	HLA class II histocompatibility antigen, DR beta 5 chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042277	0.964	peptide binding
GO:0044877	0.940	protein-containing complex binding
GO:0005102	0.939	signaling receptor binding
GO:0003823	0.904	antigen binding
GO:0042605	0.762	peptide antigen binding
GO:0030881	0.577	beta-2-microglobulin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.993	response to stimulus
GO:0002376	0.989	immune system process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.977	cellular process
GO:0002706	0.973	regulation of lymphocyte mediated immunity
GO:0019882	0.972	antigen processing and presentation
GO:0009617	0.971	response to bacterium
GO:0002822	0.967	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0031341	0.954	regulation of cell killing
GO:0002709	0.946	regulation of T cell mediated immunity
GO:0048518	0.939	positive regulation of biological process
GO:0048522	0.932	positive regulation of cellular process
GO:0006952	0.926	defense response
GO:0001910	0.904	regulation of leukocyte mediated cytotoxicity
GO:0002684	0.901	positive regulation of immune system process
GO:0048584	0.900	positive regulation of response to stimulus
GO:0050778	0.890	positive regulation of immune response
GO:0002699	0.880	positive regulation of immune effector process
GO:0002705	0.866	positive regulation of leukocyte mediated immunity
GO:0002708	0.864	positive regulation of lymphocyte mediated immunity
GO:0042742	0.849	defense response to bacterium
GO:0048002	0.842	antigen processing and presentation of peptide antigen
GO:0006955	0.840	immune response
GO:0002824	0.770	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0001914	0.765	regulation of T cell mediated cytotoxicity
GO:0051239	0.665	regulation of multicellular organismal process
GO:0002831	0.645	regulation of response to biotic stimulus
GO:0002711	0.615	positive regulation of T cell mediated immunity
GO:0019222	0.614	regulation of metabolic process
GO:0051240	0.600	positive regulation of multicellular organismal process
GO:0019884	0.598	antigen processing and presentation of exogenous antigen
GO:0031343	0.576	positive regulation of cell killing
GO:0001912	0.573	positive regulation of leukocyte mediated cytotoxicity
GO:0060255	0.562	regulation of macromolecule metabolic process
GO:0050829	0.524	defense response to Gram-negative bacterium
GO:0001817	0.512	regulation of cytokine production
GO:0048519	0.501	negative regulation of biological process
GO:0001819	0.484	positive regulation of cytokine production
GO:0002478	0.471	antigen processing and presentation of exogenous peptide antigen
GO:0032501	0.451	multicellular organismal process
GO:0045088	0.450	regulation of innate immune response
GO:0042269	0.388	regulation of natural killer cell mediated cytotoxicity
GO:0002833	0.377	positive regulation of response to biotic stimulus
GO:0051249	0.376	regulation of lymphocyte activation
GO:0002683	0.364	negative regulation of immune system process
GO:0048523	0.338	negative regulation of cellular process
GO:0050863	0.311	regulation of T cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0012505	0.985	endomembrane system
GO:0031410	0.976	cytoplasmic vesicle
GO:0030659	0.966	cytoplasmic vesicle membrane
GO:0005783	0.959	endoplasmic reticulum
GO:0042175	0.950	nuclear outer membrane-endoplasmic reticulum membrane network
GO:0098588	0.947	bounding membrane of organelle
GO:0032991	0.946	protein-containing complex
GO:0098827	0.941	endoplasmic reticulum subcompartment
GO:0098552	0.930	side of membrane
GO:0005789	0.912	endoplasmic reticulum membrane
GO:0098797	0.869	plasma membrane protein complex
GO:0005768	0.850	endosome
GO:0009986	0.843	cell surface
GO:0010008	0.486	endosome membrane
GO:0005764	0.426	lysosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]