StarFunc result for job id Q969D9

User Input

>input (159 residues)
MFPFALLYVLSVSFRKIFILQLVGLVLTYDFTNCDFEKIKAAYLSTISKDLITYMSGTKS
TEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINA
TQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969D9	1.000	1.000	4.609E-25	159	1.000	1.000	Q969D9.pdb.gz	TSLP_HUMAN Thymic stromal lymphopoietin OS=Homo sapiens OX=9606 GN=TSLP PE=1 SV=1
2	PDB:5j11A	0.670	0.926	1.064E-14	114	0.711	0.991	5j11A.pdb.gz
3	AFDB:Q9JIE6	0.721	0.811	1.705E-8	140	0.346	0.393	Q9JIE6.pdb.gz	TSLP_MOUSE Thymic stromal lymphopoietin OS=Mus musculus OX=10090 GN=Tslp PE=1 SV=1
4	PDB:4nn5A	0.625	0.901	3.203E-7	109	0.270	0.394	4nn5A.pdb.gz
5	PDB:3di3A	0.309	0.382	3.079E-1	118	0.107	0.144	3di3A.pdb.gz
6	PDB:7acoB	0.202	0.185	6.817E-1	180	0.075	0.067	7acoB.pdb.gz
7	AFDB:P34207	0.304	0.235	1.930	223	0.119	0.085	P34207.pdb.gz	PR3D4_RAT Prolactin-3D4 OS=Rattus norvegicus OX=10116 GN=Prl3d4 PE=1 SV=2
8	PDB:1li7B	0.217	0.109	2.187	375	0.113	0.048	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
9	PDB:4xguB	0.156	0.081	2.431	382	0.126	0.052	4xguB.pdb.gz	TRIP13 is a protein-remodeling AAA+ ATPase that catalyzes MAD2 conformation switching.
10	AFDB:Q9M9Q9	0.203	0.123	2.516	321	0.170	0.084	Q9M9Q9.pdb.gz	PER5_ARATH Peroxidase 5 OS=Arabidopsis thaliana OX=3702 GN=PER5 PE=3 SV=2
11	AFDB:Q9NYY1	0.306	0.285	2.653	176	0.132	0.119	Q9NYY1.pdb.gz	IL20_HUMAN Interleukin-20 OS=Homo sapiens OX=9606 GN=IL20 PE=1 SV=2
12	AFDB:Q6ZTW0	0.253	0.160	2.949	290	0.075	0.041	Q6ZTW0.pdb.gz	TPGS1_HUMAN Tubulin polyglutamylase complex subunit 1 OS=Homo sapiens OX=9606 GN=TPGS1 PE=1 SV=2
13	AFDB:Q8CJ70	0.252	0.234	2.949	176	0.126	0.114	Q8CJ70.pdb.gz	IL19_MOUSE Interleukin-19 OS=Mus musculus OX=10090 GN=Il19 PE=2 SV=1
14	PDB:4kbrB	0.172	0.148	3.005	207	0.113	0.087	4kbrB.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
15	AFDB:C5VUR1	0.279	0.262	3.110	173	0.107	0.098	C5VUR1.pdb.gz	C5VUR1_ONCMY Interleukin-22 OS=Oncorhynchus mykiss OX=8022 GN=il-22 PE=2 SV=1
16	AFDB:Q9UTR8	0.156	0.052	3.457	712	0.075	0.017	Q9UTR8.pdb.gz	RED1_SCHPO NURS complex subunit red1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=red1 PE=1 SV=2
17	AFDB:Q9FNQ1	0.193	0.025	3.646	2157	0.119	0.009	Q9FNQ1.pdb.gz	DEXHE_ARATH DExH-box ATP-dependent RNA helicase DExH14 OS=Arabidopsis thaliana OX=3702 GN=BRR2C PE=2 SV=1
18	PDB:7nvoE	0.235	0.169	3.715	249	0.113	0.072	7nvoE.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.
19	PDB:4k80A	0.177	0.146	4.130	209	0.132	0.100	4k80A.pdb.gz	Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
20	PDB:6xz0A	0.226	0.159	4.355	250	0.094	0.060	6xz0A.pdb.gz	Structural Recognition of Spectinomycin by Resistance Enzyme ANT(9) from Enterococcus faecalis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969D9	1.09e-117	330	159	1.000	1.000	TSLP_HUMAN Thymic stromal lymphopoietin OS=Homo sapiens OX=9606 GN=TSLP PE=1 SV=1
2	Q9JIE6	1.84e-27	101	140	0.371	0.421	TSLP_MOUSE Thymic stromal lymphopoietin OS=Mus musculus OX=10090 GN=Tslp PE=1 SV=1
3	Q7XA78	0.70	32.0	264	0.208	0.125	D27_ARATH Beta-carotene isomerase D27, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=D27 PE=1 SV=1
4	P97429	2.4	30.4	319	0.094	0.047	ANXA4_MOUSE Annexin A4 OS=Mus musculus OX=10090 GN=Anxa4 PE=1 SV=4
5	P09525	2.8	30.4	319	0.094	0.047	ANXA4_HUMAN Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4
6	Q383S7	5.3	29.6	313	0.088	0.045	Q383S7_TRYB2 Short-chain dehydrogenase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1780 PE=4 SV=1
7	F1QF92	7.5	29.3	2105	0.107	0.008	F1QF92_DANRE ALMS1 centrosome and basal body-associated protein OS=Danio rerio OX=7955 GN=alms1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15216 TSLP	2.1e-66	232.9	Thymic stromal lymphopoietin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000339804

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306157	0.999	Interleukin-7 receptor subunit alpha
2	9606.ENSP00000383641	0.999	Cytokine receptor-like factor 2
3	9606.ENSP00000370842	0.881	Interleukin-33
4	9606.ENSP00000231449	0.858	Interleukin-4
5	9606.ENSP00000304915	0.857	Interleukin-13
6	9606.ENSP00000363318	0.849	Cytokine receptor common subunit gamma
7	9606.ENSP00000231454	0.834	Interleukin-5
8	9606.ENSP00000264657	0.816	Signal transducer and activator of transcription 3
9	9606.ENSP00000379111	0.814	Interleukin-4 receptor subunit alpha
10	9606.ENSP00000281834	0.798	Tumor necrosis factor ligand superfamily member 4
11	9606.ENSP00000226730	0.795	Interleukin-2
12	9606.ENSP00000369293	0.772	Interleukin-2 receptor subunit alpha
13	9606.ENSP00000412209	0.751	Interleukin-5 receptor subunit alpha
14	9606.ENSP00000244174	0.745	Interleukin-9 receptor
15	9606.ENSP00000341208	0.744	Signal transducer and activator of transcription 5A
16	9606.ENSP00000219244	0.743	C-C motif chemokine 17
17	9606.ENSP00000327890	0.740	Interleukin-3 receptor subunit alpha
18	9606.ENSP00000216223	0.737	Interleukin-2 receptor subunit beta
19	9606.ENSP00000321345	0.737	Interleukin-23 receptor
20	9606.ENSP00000263851	0.736	Interleukin-7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005139	1.000	interleukin-7 receptor binding
GO:0005125	1.000	cytokine activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0002376	0.992	immune system process
GO:0050794	0.990	regulation of cellular process
GO:0044419	0.987	biological process involved in interspecies interaction between organisms
GO:0001819	0.987	positive regulation of cytokine production
GO:0048522	0.981	positive regulation of cellular process
GO:0051707	0.981	response to other organism
GO:0032101	0.980	regulation of response to external stimulus
GO:0002684	0.979	positive regulation of immune system process
GO:0006955	0.978	immune response
GO:0080134	0.978	regulation of response to stress
GO:0048584	0.978	positive regulation of response to stimulus
GO:0042127	0.974	regulation of cell population proliferation
GO:0023051	0.969	regulation of signaling
GO:0006952	0.966	defense response
GO:0048519	0.964	negative regulation of biological process
GO:0009966	0.963	regulation of signal transduction
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0031347	0.946	regulation of defense response
GO:0080090	0.945	regulation of primary metabolic process
GO:0031323	0.945	regulation of cellular metabolic process
GO:0023056	0.915	positive regulation of signaling
GO:0009967	0.904	positive regulation of signal transduction
GO:0050727	0.892	regulation of inflammatory response
GO:0051246	0.884	regulation of protein metabolic process
GO:0008284	0.882	positive regulation of cell population proliferation
GO:0098542	0.881	defense response to other organism
GO:0051173	0.860	positive regulation of nitrogen compound metabolic process
GO:0031325	0.860	positive regulation of cellular metabolic process
GO:0048523	0.856	negative regulation of cellular process
GO:0009987	0.821	cellular process
GO:0050865	0.770	regulation of cell activation
GO:0002694	0.759	regulation of leukocyte activation
GO:0032103	0.755	positive regulation of response to external stimulus
GO:0051247	0.744	positive regulation of protein metabolic process
GO:0031399	0.599	regulation of protein modification process
GO:0031349	0.571	positive regulation of defense response
GO:0042325	0.557	regulation of phosphorylation
GO:0051716	0.550	cellular response to stimulus
GO:0010941	0.546	regulation of cell death
GO:0043067	0.540	regulation of programmed cell death
GO:0042327	0.538	positive regulation of phosphorylation
GO:0042981	0.534	regulation of apoptotic process
GO:0009617	0.530	response to bacterium
GO:0031401	0.525	positive regulation of protein modification process
GO:0001932	0.523	regulation of protein phosphorylation
GO:0002696	0.496	positive regulation of leukocyte activation
GO:0001934	0.485	positive regulation of protein phosphorylation
GO:0006959	0.469	humoral immune response
GO:0043069	0.465	negative regulation of programmed cell death
GO:0043066	0.459	negative regulation of apoptotic process
GO:0050729	0.459	positive regulation of inflammatory response
GO:0032642	0.433	regulation of chemokine production
GO:0007154	0.400	cell communication
GO:0042221	0.381	response to chemical
GO:0050730	0.366	regulation of peptidyl-tyrosine phosphorylation
GO:0023052	0.357	signaling
GO:0007165	0.353	signal transduction
GO:0050731	0.350	positive regulation of peptidyl-tyrosine phosphorylation
GO:1904892	0.346	regulation of receptor signaling pathway via STAT
GO:0061844	0.341	antimicrobial humoral immune response mediated by antimicrobial peptide
GO:0032722	0.341	positive regulation of chemokine production
GO:0032675	0.331	regulation of interleukin-6 production
GO:1904894	0.331	positive regulation of receptor signaling pathway via STAT

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.629	extracellular space
GO:0043226	0.585	organelle
GO:0043227	0.566	membrane-bounded organelle
GO:0005886	0.465	plasma membrane
GO:0005622	0.351	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]