StarFunc result for job id Q969E3

User Input

>input (161 residues)
MLMPVHFLLLLLLLLGGPRTGLPHKFYKAKPIFSCLNTALSEAEKGQWEDASLLSKRSFH
YLRSRDASSGEEEEGKEKKTFPISGARGGARGTRYRYVSQAQPRGKPRQDTAKSPHRTKF
TLSLDVPTNIMNLLFNIAKAKNLRAQAAANAHLMAQIGRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969E3	1.000	1.000	1.266E-24	161	1.000	1.000	Q969E3.pdb.gz	UCN3_HUMAN Urocortin-3 OS=Homo sapiens OX=9606 GN=UCN3 PE=1 SV=2
2	AFDB:A1YKY5	0.248	0.244	5.953E-14	164	0.665	0.652	A1YKY5.pdb.gz	A1YKY5_RAT Urocortin 3 OS=Rattus norvegicus OX=10116 GN=Ucn3 PE=3 SV=1
3	AFDB:Q924A4	0.465	0.459	7.956E-14	164	0.646	0.634	Q924A4.pdb.gz	UCN3_MOUSE Urocortin-3 OS=Mus musculus OX=10090 GN=Ucn3 PE=2 SV=1
4	AFDB:P25587	0.166	0.105	5.978E-1	256	0.168	0.105	P25587.pdb.gz	LDB16_YEAST Protein LDB16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LDB16 PE=1 SV=2
5	AFDB:Q8JZX4	0.243	0.116	9.929E-1	405	0.124	0.049	Q8JZX4.pdb.gz	SPF45_MOUSE Splicing factor 45 OS=Mus musculus OX=10090 GN=Rbm17 PE=1 SV=1
6	AFDB:Q9NV56	0.135	0.128	9.929E-1	204	0.124	0.098	Q9NV56.pdb.gz	MRGBP_HUMAN MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1
7	AFDB:B8ZZA1	0.135	0.152	1.068	131	0.118	0.145	B8ZZA1.pdb.gz	B8ZZA1_HUMAN Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=1
8	AFDB:Q8NCY6	0.180	0.105	1.427	345	0.143	0.067	Q8NCY6.pdb.gz	MSD4_HUMAN Myb/SANT-like DNA-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=MSANTD4 PE=1 SV=1
9	AFDB:Q9VLV7	0.148	0.064	1.649	611	0.137	0.036	Q9VLV7.pdb.gz	SPZ3_DROME Protein spaetzle 3 OS=Drosophila melanogaster OX=7227 GN=spz3 PE=2 SV=2
10	AFDB:P24869	0.143	0.055	1.773	491	0.124	0.041	P24869.pdb.gz	CG22_YEAST G2/mitotic-specific cyclin-2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CLB2 PE=1 SV=1
11	PDB:6bk8E	0.190	0.165	4.559	186	0.112	0.097	6bk8E.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.
12	PDB:5gm6P	0.206	0.138	6.550	246	0.112	0.073	5gm6P.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969E3	6.65e-118	331	161	1.000	1.000	UCN3_HUMAN Urocortin-3 OS=Homo sapiens OX=9606 GN=UCN3 PE=1 SV=2
2	A1YKY5	3.50e-63	193	164	0.665	0.652	A1YKY5_RAT Urocortin 3 OS=Rattus norvegicus OX=10116 GN=Ucn3 PE=3 SV=1
3	Q924A4	3.60e-55	172	164	0.658	0.646	UCN3_MOUSE Urocortin-3 OS=Mus musculus OX=10090 GN=Ucn3 PE=2 SV=1
4	Q91WW1	4.71e-05	42.7	109	0.130	0.193	UCN2_RAT Urocortin-2 OS=Rattus norvegicus OX=10116 GN=Ucn2 PE=3 SV=1
5	Q99ML8	6.33e-05	42.4	113	0.130	0.186	UCN2_MOUSE Urocortin-2 OS=Mus musculus OX=10090 GN=Ucn2 PE=1 SV=2
6	Q96RP3	4.4	28.9	112	0.099	0.143	UCN2_HUMAN Urocortin-2 OS=Homo sapiens OX=9606 GN=UCN2 PE=1 SV=1
7	P25823	4.6	30.0	2515	0.099	0.006	TUD_DROME Maternal protein tudor OS=Drosophila melanogaster OX=7227 GN=tud PE=1 SV=2
8	Q703P0	5.4	29.3	167	0.124	0.120	Q703P0_CHICK Corticotropin releasing hormone OS=Gallus gallus OX=9031 GN=CRH PE=2 SV=1
9	P02751	6.7	29.6	2477	0.087	0.006	FINC_HUMAN Fibronectin OS=Homo sapiens OX=9606 GN=FN1 PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00473 CRF	3e-09	48.1	Corticotropin-releasing factor family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369798

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340943	0.998	Corticotropin-releasing factor receptor 2
2	9606.ENSP00000381333	0.990	Corticotropin-releasing factor receptor 1
3	9606.ENSP00000276571	0.989	Corticoliberin
4	9606.ENSP00000273610	0.981	Urocortin-2
5	9606.ENSP00000296099	0.970	Urocortin
6	9606.ENSP00000274368	0.914	Corticotropin-releasing factor-binding protein
7	9606.ENSP00000387662	0.705	Glucagon
8	9606.ENSP00000362080	0.690	Synaptotagmin-like protein 4
9	9606.ENSP00000277746	0.641	Nuclear receptor-binding factor 2
10	9606.ENSP00000295886	0.632	Homeobox protein Nkx-6.1
11	9606.ENSP00000357581	0.577	Homeobox protein Nkx-6.2
12	9606.ENSP00000382791	0.574	Glutamate receptor ionotropic, kainate 1
13	9606.ENSP00000356951	0.561	Protein Flattop
14	9606.ENSP00000323568	0.560	Solute carrier family 2, facilitated glucose transporter member 2
15	9606.ENSP00000287641	0.548	Somatostatin
16	9606.ENSP00000380432	0.548	Insulin
17	9606.ENSP00000261707	0.545	Sodium-dependent serotonin transporter
18	9606.ENSP00000415011	0.527	Zinc transporter 8
19	9606.ENSP00000303960	0.525	ATP-binding cassette sub-family C member 8
20	9606.ENSP00000384092	0.525	Pro-opiomelanocortin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0071855	1.000	neuropeptide receptor binding
GO:0051428	1.000	peptide hormone receptor binding
GO:0051429	0.990	corticotropin-releasing hormone receptor binding
GO:0098772	0.711	molecular function regulator activity
GO:0140677	0.488	molecular function activator activity
GO:0048018	0.477	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0007165	0.989	signal transduction
GO:0007189	0.980	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0010033	0.958	response to organic substance
GO:0032870	0.873	cellular response to hormone stimulus
GO:0009755	0.838	hormone-mediated signaling pathway
GO:0065008	0.301	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.629	intracellular anatomical structure
GO:0043227	0.502	membrane-bounded organelle
GO:0043229	0.448	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]