StarFunc result for job id Q969F0

User Input

>input (183 residues)
MAGGPPNTKAEMEMSLAEELNHGRQGENQEHLVIAEMMELGSRSRGASQKKQKLEQKAAG
SASAKRVWNMTATRPKKMGSQLPKPRMLRESGHGDAHLQEYAGNFQGIRFHYDRNPGTDA
VAQTSLEEFNVLEMEVMRRQLYAVNRRLRALEEQGATWRHRETLIIAVLVSASIANLWLW
MNQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969F0	1.000	1.000	2.899E-26	183	1.000	1.000	Q969F0.pdb.gz	FATE1_HUMAN Fetal and adult testis-expressed transcript protein OS=Homo sapiens OX=9606 GN=FATE1 PE=1 SV=1
2	AFDB:O14525	0.195	0.033	4.546E-1	1302	0.131	0.018	O14525.pdb.gz	ASTN1_HUMAN Astrotactin-1 OS=Homo sapiens OX=9606 GN=ASTN1 PE=1 SV=3
3	AFDB:A8JNQ4	0.232	0.063	1.006	796	0.087	0.020	A8JNQ4.pdb.gz	A8JNQ4_DROME RNA-binding Fox protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=2
4	AFDB:Q8INJ8	0.179	0.044	1.755	1052	0.104	0.018	Q8INJ8.pdb.gz	Q8INJ8_DROME Tyrosine-protein kinase OS=Drosophila melanogaster OX=7227 GN=Csk PE=3 SV=2
5	AFDB:A0A0S2Z5H3	0.153	0.047	2.228	643	0.093	0.026	A0A0S2Z5H3.pdb.gz	A0A0S2Z5H3_HUMAN Clathrin interactor 1 isoform 2 (Fragment) OS=Homo sapiens OX=9606 GN=CLINT1 PE=2 SV=1
6	AFDB:M9NFQ7	0.234	0.055	2.412	962	0.120	0.023	M9NFQ7.pdb.gz	M9NFQ7_DROME RNA-binding Fox protein 1, isoform H OS=Drosophila melanogaster OX=7227 GN=Rbfox1 PE=4 SV=1
7	AFDB:Q32P44	0.212	0.056	2.412	896	0.126	0.026	Q32P44.pdb.gz	EMAL3_HUMAN Echinoderm microtubule-associated protein-like 3 OS=Homo sapiens OX=9606 GN=EML3 PE=1 SV=1
8	AFDB:Q99LG0	0.209	0.057	2.412	825	0.049	0.011	Q99LG0.pdb.gz	UBP16_MOUSE Ubiquitin carboxyl-terminal hydrolase 16 OS=Mus musculus OX=10090 GN=Usp16 PE=1 SV=2
9	AFDB:Q57UJ7	0.183	0.067	2.612	531	0.066	0.023	Q57UJ7.pdb.gz	Q57UJ7_TRYB2 Coatomer subunit delta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.5H5.420 PE=3 SV=1
10	AFDB:A0A2R8RYD3	0.279	0.063	2.828	948	0.180	0.035	A0A2R8RYD3.pdb.gz
11	PDB:7mqaNS	0.137	0.030	7.282	914	0.066	0.013	7mqaNS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:7odrd	0.108	0.083	9.242	259	0.066	0.046	7odrd.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969F0	5.25e-135	376	183	1.000	1.000	FATE1_HUMAN Fetal and adult testis-expressed transcript protein OS=Homo sapiens OX=9606 GN=FATE1 PE=1 SV=1
2	Q3ZCD8	4.04e-05	44.7	218	0.115	0.096	MFF_BOVIN Mitochondrial fission factor OS=Bos taurus OX=9913 GN=MFF PE=2 SV=1
3	Q4KM98	4.28e-05	44.7	218	0.115	0.096	MFF_RAT Mitochondrial fission factor OS=Rattus norvegicus OX=10116 GN=Mff PE=1 SV=1
4	Q6PCP5	1.72e-04	43.1	291	0.109	0.069	MFF_MOUSE Mitochondrial fission factor OS=Mus musculus OX=10090 GN=Mff PE=1 SV=1
5	Q9GZY8	2.04e-04	43.1	342	0.104	0.056	MFF_HUMAN Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF PE=1 SV=1
6	A0A0A0MS29	2.26e-04	42.7	221	0.186	0.154	A0A0A0MS29_HUMAN Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF PE=1 SV=1
7	Q6P5H2	1.1	32.3	1864	0.087	0.009	NEST_MOUSE Nestin OS=Mus musculus OX=10090 GN=Nes PE=1 SV=1
8	Q6U8D7	2.0	31.2	431	0.224	0.095	FOXP3_MACFA Forkhead box protein P3 OS=Macaca fascicularis OX=9541 GN=FOXP3 PE=2 SV=1
9	Q38DW1	3.5	30.8	726	0.115	0.029	Q38DW1_TRYB2 Spindle assembly abnormal protein 6 N-terminal domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.1930 PE=4 SV=1
10	P21263	7.2	29.6	1893	0.082	0.008	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
11	Q28115	8.9	29.3	428	0.148	0.063	GFAP_BOVIN Glial fibrillary acidic protein OS=Bos taurus OX=9913 GN=GFAP PE=1 SV=2
12	F1RR02	9.3	29.3	468	0.148	0.058	F1RR02_PIG Glial fibrillary acidic protein OS=Sus scrofa OX=9823 GN=GFAP PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03564 DUF1759	2.9e+02	12.8	Protein of unknown function (DUF1759)
2	PF05644 Miff	1.7e-05	36.3	Mitochondrial and peroxisomal fission factor Mff

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359375

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419454	0.796	Probable E3 ubiquitin-protein ligase RNF183
2	9606.ENSP00000359498	0.736	Fragile X mental retardation 1 neighbor protein
3	9606.ENSP00000216115	0.712	Bcl-2-interacting killer
4	9606.ENSP00000312709	0.676	Transcription initiation factor TFIID subunit 7
5	9606.ENSP00000359546	0.635	Sperm protein associated with the nucleus on the X chromosome D
6	9606.ENSP00000242819	0.633	Coiled-coil domain containing 70
7	9606.ENSP00000351884	0.632	Sperm protein associated with the nucleus on the X chromosome C
8	9606.ENSP00000310303	0.622	Testis- and ovary-specific PAZ domain-containing protein 1
9	9606.ENSP00000418803	0.619	Complex I assembly factor TIMMDC1, mitochondrial
10	9606.ENSP00000358857	0.585	Emerin
11	9606.ENSP00000453940	0.580	Coiled-coil domain containing 175
12	9606.ENSP00000426978	0.566	Nuclear RNA export factor 5
13	9606.ENSP00000366118	0.535	Protein SSX1
14	9606.ENSP00000484645	0.524	Nuclear RNA export factor 2B
15	9606.ENSP00000485586	0.524	Nuclear RNA export factor 2
16	9606.ENSP00000364752	0.519	X antigen family member 1A
17	9606.ENSP00000364766	0.519	X antigen family member 1B
18	9606.ENSP00000306776	0.517	Coiled-coil domain containing 110

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0031625	1.000	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0048523	0.979	negative regulation of cellular process
GO:0042981	0.976	regulation of apoptotic process
GO:0055082	0.956	intracellular chemical homeostasis
GO:0098771	0.952	inorganic ion homeostasis
GO:0030003	0.951	intracellular monoatomic cation homeostasis
GO:0051560	0.926	mitochondrial calcium ion homeostasis
GO:0043066	0.833	negative regulation of apoptotic process
GO:0009987	0.633	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005783	0.997	endoplasmic reticulum
GO:0044233	0.995	mitochondria-associated endoplasmic reticulum membrane
GO:0005741	0.995	mitochondrial outer membrane
GO:0005634	0.718	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]