StarFunc result for job id Q969F1

User Input

>input (213 residues)
MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSC
VFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENI
GGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQ
EKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969F1	0.999	0.999	2.274E-36	213	1.000	1.000	Q969F1.pdb.gz	TF3C6_HUMAN General transcription factor 3C polypeptide 6 OS=Homo sapiens OX=9606 GN=GTF3C6 PE=1 SV=1
2	PDB:6yj6C	0.292	0.195	2.088E-3	330	0.066	0.042	6yj6C.pdb.gz
3	PDB:7edxG	0.238	0.328	8.420E-3	145	0.080	0.117	7edxG.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
4	PDB:5msmB	0.261	0.391	1.126E-2	132	0.075	0.121	5msmB.pdb.gz	Structural studies of RFC(C)(tf18) reveal a novel chromatin recruitment role for Dcc1.
5	PDB:7a6hN	0.266	0.298	1.691E-2	186	0.075	0.086	7a6hN.pdb.gz	Cryo-EM structures of human RNA polymerase III in its unbound and transcribing states.
6	PDB:6s1cF	0.290	0.216	1.899E-2	299	0.085	0.060	6s1cF.pdb.gz	Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
7	PDB:7vbaN	0.235	0.306	2.852E-2	151	0.066	0.093	7vbaN.pdb.gz	Structure of the human RNA polymerase I elongation complex.
8	PDB:7d58N	0.240	0.329	3.022E-2	136	0.075	0.118	7d58N.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
9	PDB:6o9lS	0.249	0.292	4.041E-2	176	0.056	0.068	6o9lS.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
10	PDB:3pufI	0.220	0.309	6.432E-2	140	0.038	0.057	3pufI.pdb.gz
11	PDB:4c3hN	0.178	0.249	7.656E-2	139	0.075	0.115	4c3hN.pdb.gz	Crystal Structure of the 14-Subunit RNA Polymerase I
12	AFDB:Q94546	0.184	0.069	7.571E-1	725	0.178	0.052	Q94546.pdb.gz	ATU_DROME Another transcription unit protein OS=Drosophila melanogaster OX=7227 GN=Atu PE=1 SV=2
13	AFDB:Q5SSG4	0.097	0.034	1.205	860	0.146	0.036	Q5SSG4.pdb.gz	GA2L2_MOUSE GAS2-like protein 2 OS=Mus musculus OX=10090 GN=Gas2l2 PE=1 SV=1
14	AFDB:Q6FSI9	0.097	0.026	1.434	992	0.099	0.021	Q6FSI9.pdb.gz	Q6FSI9_CANGA Candida glabrata strain CBS138 chromosome G complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0G10219g PE=4 SV=1
15	AFDB:Q95R51	0.113	0.045	2.283	969	0.160	0.035	Q95R51.pdb.gz	Q95R51_DROME SD07884p OS=Drosophila melanogaster OX=7227 GN=D12 PE=2 SV=1
16	AFDB:Q9FND0	0.099	0.056	2.283	450	0.099	0.047	Q9FND0.pdb.gz	Q9FND0_ARATH Gb
17	AFDB:Q8TF40	0.093	0.026	2.718	1166	0.122	0.022	Q8TF40.pdb.gz	FNIP1_HUMAN Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3
18	AFDB:P36110	0.129	0.085	3.052	329	0.075	0.049	P36110.pdb.gz	PRY2_YEAST Protein PRY2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PRY2 PE=1 SV=1
19	AFDB:Q9URT4	0.114	0.045	3.052	697	0.122	0.037	Q9URT4.pdb.gz	AMS2_SCHPO CENP-A multicopy suppressor protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ams2 PE=1 SV=2
20	AFDB:Q9P278	0.118	0.029	3.634	1114	0.131	0.025	Q9P278.pdb.gz	FNIP2_HUMAN Folliculin-interacting protein 2 OS=Homo sapiens OX=9606 GN=FNIP2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969F1	7.16e-156	431	213	1.000	1.000	TF3C6_HUMAN General transcription factor 3C polypeptide 6 OS=Homo sapiens OX=9606 GN=GTF3C6 PE=1 SV=1
2	A6X980	1.7	30.8	120	0.047	0.083	SFC7_SCHPO Transcription factor tau subunit sfc7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sfc7 PE=1 SV=1
3	Q6DGY6	1.9	32.0	751	0.103	0.029	Q6DGY6_DANRE SEC63-like (S. cerevisiae) OS=Danio rerio OX=7955 GN=zgc:92718 PE=1 SV=1
4	D3WZ86	4.7	30.0	207	0.099	0.101	NAAB_BRASZ 5-nitrosalicylic acid 1,2-dioxygenase OS=Bradyrhizobium sp. OX=376 GN=naaB PE=1 SV=1
5	Q940G6	4.9	30.4	344	0.094	0.058	GID1C_ARATH Gibberellin receptor GID1C OS=Arabidopsis thaliana OX=3702 GN=GID1C PE=1 SV=1
6	M9PDQ2	5.8	30.4	1011	0.061	0.013	M9PDQ2_DROME Tousled-like kinase, isoform L OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
7	Q8IRT8	7.6	30.0	1463	0.061	0.009	Q8IRT8_DROME Tousled-like kinase, isoform B OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=3
8	O95613	8.0	30.0	3336	0.070	0.004	PCNT_HUMAN Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4
9	M9PIZ6	8.5	30.0	1265	0.061	0.010	M9PIZ6_DROME Tousled-like kinase, isoform K OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
10	Q1RL19	8.5	30.0	1255	0.061	0.010	Q1RL19_DROME LD15160p OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
11	Q8IRT7	8.5	30.0	1254	0.061	0.010	Q8IRT7_DROME Tousled-like kinase, isoform C OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=4
12	B7Z120	8.7	30.0	1242	0.061	0.010	B7Z120_DROME Tousled-like kinase, isoform I OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
13	B7Z126	8.9	30.0	1489	0.061	0.009	B7Z126_DROME Tousled-like kinase, isoform G OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=1
14	Q9W4Q4	9.0	29.6	1266	0.061	0.010	Q9W4Q4_DROME BcDNA.GH07910 OS=Drosophila melanogaster OX=7227 GN=Tlk PE=1 SV=2
15	A4IGE1	9.2	29.6	472	0.099	0.044	A4IGE1_DANRE Kelch-like protein 42 OS=Danio rerio OX=7955 GN=si:ch211-234f20.7 PE=2 SV=1
16	P32505	9.7	29.6	525	0.089	0.036	NAB2_YEAST Nuclear polyadenylated RNA-binding protein NAB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NAB2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10419 TFIIIC_sub6	1.1e-14	65.6	TFIIIC subunit triple barrel domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357863

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000361180	0.994	General transcription factor 3C polypeptide 5
2	9606.ENSP00000361219	0.994	General transcription factor 3C polypeptide 4
3	9606.ENSP00000263956	0.986	General transcription factor 3C polypeptide 3
4	9606.ENSP00000352536	0.986	General transcription factor 3C polypeptide 2
5	9606.ENSP00000348510	0.982	General transcription factor 3C polypeptide 1
6	9606.ENSP00000402338	0.815	Ribosome production factor 2 homolog
7	9606.ENSP00000357880	0.791	S-adenosylmethionine decarboxylase proenzyme
8	9606.ENSP00000365362	0.753	Mitochondrial coiled-coil domain 1
9	9606.ENSP00000357840	0.743	Sodium-dependent glucose transporter 1
10	9606.ENSP00000220659	0.720	Transcription factor IIIB 50 kDa subunit
11	9606.ENSP00000319281	0.676	Brain abundant membrane attached signal protein 1
12	9606.ENSP00000293860	0.647	DNA-directed RNA polymerase III subunit RPC10
13	9606.ENSP00000360034	0.626	Plasminogen activator inhibitor 1 RNA-binding protein
14	9606.ENSP00000324124	0.623	DNA-directed RNA polymerases I, II, and III subunit RPABC5
15	9606.ENSP00000342889	0.623	DNA-directed RNA polymerases I, II, and III subunit RPABC4
16	9606.ENSP00000298875	0.616	Cleavage and polyadenylation specificity factor subunit 2
17	9606.ENSP00000351575	0.610	Transcription factor TFIIIB component B'' homolog
18	9606.ENSP00000380904	0.610	DNA-directed RNA polymerase III subunit RPC4
19	9606.ENSP00000415536	0.609	DNA-directed RNA polymerases I, II, and III subunit RPABC3
20	9606.ENSP00000361465	0.608	DNA-directed RNA polymerases I and III subunit RPAC1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000995	1.000	RNA polymerase III general transcription initiation factor activity
GO:0003677	1.000	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0006383	0.989	transcription by RNA polymerase III
GO:0009303	0.959	rRNA transcription
GO:0006399	0.957	tRNA metabolic process
GO:0042797	0.373	tRNA transcription by RNA polymerase III
GO:0042791	0.373	5S class rRNA transcription by RNA polymerase III
GO:0050789	0.314	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0090576	0.998	RNA polymerase III transcription regulator complex
GO:0016604	0.998	nuclear body
GO:0000127	0.747	transcription factor TFIIIC complex
GO:0140513	0.420	nuclear protein-containing complex
GO:0005737	0.350	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]