StarFunc result for job id Q969F2

User Input

>input (451 residues)
MGKLQSKHAAAARKRRESPEGDSFVASAYASGRKGAEEAERRARDKQELPNGDPKEGPFR
EDQCPLQVALPAEKAEGREHPGQLLSADDGERAANREGPRGPGGQRLNIDALQCDVSVEE
DDRQEWTFTLYDFDNCGKVTREDMSSLMHTIYEVVDASVNHSSGSSKTLRVKLTVSPEPS
SKRKEGPPAGQDREPTRCRMEGELAEEPRVADRRLSAHVRRPSTDPQPCSERGPYCVDEN
TERRNHYLDLAGIENYTSRFGPGSPPVQAKQEPQGRASHLQARSRSQEPDTHAVHHRRSQ
VLVEHVVPASEPAARALDTQPRPKGPEKQFLKSPKGSGKPPGVPASSKSGKAFSYYLPAV
LPPQAPQDGHHLPQPPPPPYGHKRYRQKGREGHSPLKAPHAQPATVEHEVVRDLPPTPAG
EGYAVPVIQRHEHHHHHEHHHHHHHHHFHPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969F2	0.999	0.999	3.590E-65	451	1.000	1.000	Q969F2.pdb.gz	NKD2_HUMAN Protein naked cuticle homolog 2 OS=Homo sapiens OX=9606 GN=NKD2 PE=1 SV=1
2	AFDB:Q2TJA6	0.224	0.229	2.283E-23	440	0.432	0.443	Q2TJA6.pdb.gz	NKD1_DANRE Protein naked cuticle homolog 1 OS=Danio rerio OX=7955 GN=nkd1 PE=2 SV=1
3	AFDB:Q969G9	0.242	0.234	6.041E-22	470	0.441	0.423	Q969G9.pdb.gz	NKD1_HUMAN Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1
4	AFDB:A1Z6W3	0.062	0.027	1.330E-2	1299	0.160	0.055	A1Z6W3.pdb.gz	PRIC1_DROME Protein prickle OS=Drosophila melanogaster OX=7227 GN=pk PE=1 SV=1
5	AFDB:Q9Y6F6	0.074	0.045	8.145E-2	904	0.173	0.086	Q9Y6F6.pdb.gz	IRAG1_HUMAN Inositol 1,4,5-triphosphate receptor associated 1 OS=Homo sapiens OX=9606 GN=IRAG1 PE=1 SV=4
6	AFDB:F1LYX9	0.067	0.034	1.237E-1	1128	0.146	0.059	F1LYX9.pdb.gz	F1LYX9_RAT Desmoglein 2 OS=Rattus norvegicus OX=10116 GN=Dsg2 PE=1 SV=2
7	AFDB:O61708	0.069	0.048	1.635E-1	712	0.140	0.088	O61708.pdb.gz	O61708_CAEEL Protein lingerer OS=Caenorhabditis elegans OX=6239 GN=pqn-59 PE=1 SV=2
8	AFDB:P11274	0.063	0.027	1.753E-1	1271	0.157	0.056	P11274.pdb.gz	BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2
9	AFDB:B9G5N1	0.057	0.035	3.520E-1	844	0.166	0.089	B9G5N1.pdb.gz	PAIR3_ORYSJ Meiosis-specific protein PAIR3 OS=Oryza sativa subsp. japonica OX=39947 GN=PAIR3 PE=2 SV=1
10	AFDB:A0A087WVZ6	0.081	0.041	4.988E-1	1136	0.137	0.055	A0A087WVZ6.pdb.gz	A0A087WVZ6_HUMAN Zinc finger MYND-type containing 8 OS=Homo sapiens OX=9606 GN=ZMYND8 PE=1 SV=2
11	PDB:7dvqR	0.053	0.096	7.897	241	0.031	0.058	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:7w59R	0.049	0.075	7.897	280	0.060	0.096	7w59R.pdb.gz	Mechanism of exon ligation by human spliceosome.
13	PDB:7mqaNA	0.051	0.076	8.467	295	0.053	0.081	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969F2	0.0	911	451	1.000	1.000	NKD2_HUMAN Protein naked cuticle homolog 2 OS=Homo sapiens OX=9606 GN=NKD2 PE=1 SV=1
2	A4ZNR4	7.39e-96	296	409	0.432	0.477	NKD2_DANRE Protein naked cuticle homolog 2 OS=Danio rerio OX=7955 GN=nkd2 PE=2 SV=1
3	A0A803J5K4	3.94e-92	288	453	0.432	0.430	A0A803J5K4_XENTR Protein naked cuticle homolog OS=Xenopus tropicalis OX=8364 GN=nkd1 PE=3 SV=1
4	Q99MH6	1.53e-82	264	471	0.437	0.418	NKD1_MOUSE Protein naked cuticle homolog 1 OS=Mus musculus OX=10090 GN=Nkd1 PE=1 SV=1
5	Q969G9	2.10e-78	253	470	0.441	0.423	NKD1_HUMAN Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1
6	Q2TJA6	2.08e-67	223	440	0.412	0.423	NKD1_DANRE Protein naked cuticle homolog 1 OS=Danio rerio OX=7955 GN=nkd1 PE=2 SV=1
7	I3ITM9	5.75e-42	154	384	0.364	0.427	I3ITM9_DANRE Protein naked cuticle homolog OS=Danio rerio OX=7955 GN=LOC100500933 PE=3 SV=1
8	Q9VVV9	9.49e-11	66.6	928	0.075	0.037	NKD_DROME Protein naked cuticle OS=Drosophila melanogaster OX=7227 GN=nkd PE=1 SV=3
9	P37236	2.34e-04	44.3	187	0.035	0.086	FRQ1_DROME Frequenin-1 OS=Drosophila melanogaster OX=7227 GN=Frq1 PE=1 SV=2
10	P36608	4.28e-04	43.5	191	0.038	0.089	NCS1_CAEEL Neuronal calcium sensor 1 OS=Caenorhabditis elegans OX=6239 GN=ncs-1 PE=2 SV=2
11	Q804C0	5.15e-04	43.1	190	0.035	0.084	Q804C0_DANRE Neuronal calcium sensor 1 OS=Danio rerio OX=7955 GN=ncs1 PE=2 SV=1
12	Q9JJ69	6.62e-04	43.9	270	0.033	0.056	KCIP2_MOUSE Kv channel-interacting protein 2 OS=Mus musculus OX=10090 GN=Kcnip2 PE=1 SV=2
13	Q9JM59	6.99e-04	43.5	270	0.033	0.056	KCIP2_RAT Kv channel-interacting protein 2 OS=Rattus norvegicus OX=10116 GN=Kcnip2 PE=1 SV=2
14	Q9NS61	7.51e-04	43.5	270	0.033	0.056	KCIP2_HUMAN Kv channel-interacting protein 2 OS=Homo sapiens OX=9606 GN=KCNIP2 PE=1 SV=3
15	P62166	8.84e-04	42.7	190	0.035	0.084	NCS1_HUMAN Neuronal calcium sensor 1 OS=Homo sapiens OX=9606 GN=NCS1 PE=1 SV=2
16	P62167	8.84e-04	42.7	190	0.035	0.084	NCS1_CHICK Neuronal calcium sensor 1 OS=Gallus gallus OX=9031 GN=NCS1 PE=1 SV=2
17	P62168	8.84e-04	42.7	190	0.035	0.084	NCS1_RAT Neuronal calcium sensor 1 OS=Rattus norvegicus OX=10116 GN=Ncs1 PE=1 SV=2
18	Q8BNY6	8.84e-04	42.7	190	0.035	0.084	NCS1_MOUSE Neuronal calcium sensor 1 OS=Mus musculus OX=10090 GN=Ncs1 PE=1 SV=3
19	Q4WLA4	0.001	42.0	190	0.040	0.095	Q4WLA4_ASPFU Calcium sensor (NCS-1), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G14240 PE=4 SV=1
20	Q9VWX8	0.001	42.4	187	0.035	0.086	FRQ2_DROME Frequenin-2 OS=Drosophila melanogaster OX=7227 GN=Frq2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13499 EF-hand_7	1.6e+02	14.2	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368169	0.991	Segment polarity protein dishevelled homolog DVL-1
2	9606.ENSP00000316054	0.946	Segment polarity protein dishevelled homolog DVL-3
3	9606.ENSP00000005340	0.944	Segment polarity protein dishevelled homolog DVL-2
4	9606.ENSP00000268459	0.820	Protein naked cuticle homolog 1
5	9606.ENSP00000295704	0.757	E3 ubiquitin-protein ligase RNF25
6	9606.ENSP00000295400	0.751	Protransforming growth factor alpha
7	9606.ENSP00000264335	0.682	14-3-3 protein epsilon
8	9606.ENSP00000216416	0.613	Protein cornichon homolog 1
9	9606.ENSP00000328818	0.535	Probable G-protein coupled receptor 132
10	9606.ENSP00000262457	0.522	Inversin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019899	0.878	enzyme binding
GO:0032036	0.876	myosin heavy chain binding
GO:0031625	0.872	ubiquitin protein ligase binding
GO:0051117	0.863	ATPase binding
GO:0019838	0.861	growth factor binding
GO:0060090	0.802	molecular adaptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0009987	0.991	cellular process
GO:0048523	0.991	negative regulation of cellular process
GO:0010646	0.987	regulation of cell communication
GO:0048518	0.986	positive regulation of biological process
GO:0023051	0.985	regulation of signaling
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0048585	0.985	negative regulation of response to stimulus
GO:0090090	0.980	negative regulation of canonical Wnt signaling pathway
GO:0010604	0.979	positive regulation of macromolecule metabolic process
GO:0051246	0.978	regulation of protein metabolic process
GO:0051173	0.977	positive regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0051247	0.967	positive regulation of protein metabolic process
GO:0010468	0.959	regulation of gene expression
GO:0031325	0.952	positive regulation of cellular metabolic process
GO:0009894	0.913	regulation of catabolic process
GO:0032879	0.910	regulation of localization
GO:0032880	0.901	regulation of protein localization
GO:0042176	0.870	regulation of protein catabolic process
GO:0009896	0.855	positive regulation of catabolic process
GO:0051641	0.842	cellular localization
GO:0071840	0.814	cellular component organization or biogenesis
GO:0045732	0.804	positive regulation of protein catabolic process
GO:0016043	0.797	cellular component organization
GO:0008104	0.795	protein localization
GO:0050896	0.618	response to stimulus
GO:1903829	0.485	positive regulation of protein localization
GO:0051716	0.480	cellular response to stimulus
GO:0050793	0.403	regulation of developmental process
GO:0019219	0.400	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.366	regulation of RNA metabolic process
GO:0007165	0.362	signal transduction
GO:0010647	0.357	positive regulation of cell communication
GO:0023056	0.356	positive regulation of signaling
GO:0010628	0.350	positive regulation of gene expression
GO:0009967	0.348	positive regulation of signal transduction
GO:0032501	0.338	multicellular organismal process
GO:0048856	0.311	anatomical structure development
GO:0031329	0.302	regulation of cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0012505	0.998	endomembrane system
GO:0005886	0.998	plasma membrane
GO:0031410	0.991	cytoplasmic vesicle
GO:0032991	0.958	protein-containing complex
GO:0098590	0.911	plasma membrane region
GO:0030133	0.897	transport vesicle
GO:0016328	0.878	lateral plasma membrane
GO:0045178	0.874	basal part of cell
GO:0016323	0.862	basolateral plasma membrane
GO:0099503	0.809	secretory vesicle
GO:0070382	0.734	exocytic vesicle
GO:0070013	0.419	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]