StarFunc result for job id Q969F9

User Input

>input (1004 residues)
MVQLYNLHPFGSQQVVPCKLEPDRFCGGGRDALFVAAGCKVEAFAVAGQELCQPRCAFST
LGRVLRLAYSEAGDYLVAIEEKNKATFLRAYVNWRNKRTENSRVCIRMIGHNVEGPFSKA
FRDQMYIIEMPLSEAPLCISCCPVKGDLLVGCTNKLVLFSLKYQIINEEFSLLDFERSLI
IHIDNITPVEVSFCVGYVAVMSDLEVLIVKLESGPKNGERVHHHPHKTNNRIRRTEEGIS
NEISQLESDDFVICQKPLELLGEKSEQSGLSVTLESTGLADEKRKYSHFQHLLYRRFAPD
ISSYVLSDDIKLHSLQLLPIYQTGSLTSDGKNLSQEKELLSLFCFFSLPHVGYLYMVVKS
VELMSVYQYPEKSQQAVLTPQFLHVITSNNLQCFTVRCSAAAAREEDPYMDTTLKACPPV
SMDVCALRIQLFIGLKAICHFKNHIILLTKAEPEAIPERRQSPKRLLSRKDTSVKIKIPP
VAEAGWNLYIVNTISPVQLYKEMVDYSNTYKTVKTQSCIHLLSEAHLLVRAALMDASQLE
PGEKAELLEAFKESCGHLGDCYSRLDSQHSHLTLPYYKMSGLSMAEVLARTDWTVEDGLQ
KYERGLIFYINHSLYENLDEELNEELAAKVVQMFYVAEPKQVPHILCSPSMKNINPLTAM
SYLRKLDTSGFSSILVTLTKAAVALKMGDLDMHRNEMKSHSEMKLVCGFILEPRLLIQQR
KGQIVPTELALHLKETQPGLLVASVLGLQKNNKIGIEEADSFFKVLCAKDEDTIPQLLVD
FWEAQLVACLPDVVLQELFFKLTSQYIWRLSKRQPPDTTPLRTSEDLINACSHYGLIYPW
VHVVISSDSLADKNYTEDLSKLQSLICGPSFDIASIIPFLEPLSEDTIAGLSVHVLCRTR
LKEYEQCIDILLERCPEAVIPYANHELKEENRTLWWKKLLPELCQRIKCGGEKYQLYLSS
LKETLSIVAVELELKDFMNVLPEDGTATFFLPYLLYCSRKKPLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q91VB4	0.944	0.946	0.000	1002	0.809	0.810	Q91VB4.pdb.gz	HPS3_MOUSE BLOC-2 complex member HPS3 OS=Mus musculus OX=10090 GN=Hps3 PE=2 SV=2
2	AFDB:Q969F9	1.000	1.000	0.000	1004	1.000	1.000	Q969F9.pdb.gz	HPS3_HUMAN BLOC-2 complex member HPS3 OS=Homo sapiens OX=9606 GN=HPS3 PE=1 SV=1
3	AFDB:A0A0R4IZE2	0.881	0.882	2.615E-96	1003	0.478	0.479	A0A0R4IZE2.pdb.gz	A0A0R4IZE2_DANRE HPS3 biogenesis of lysosomal organelles complex 2 subunit 1 OS=Danio rerio OX=7955 GN=zgc:152969 PE=4 SV=1
4	AFDB:A0AUQ0	0.411	0.772	4.312E-42	524	0.216	0.414	A0AUQ0.pdb.gz
5	AFDB:Q57YS6	0.296	0.271	2.639E-14	1123	0.119	0.106	Q57YS6.pdb.gz	Q57YS6_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.10K10.560 PE=4 SV=1
6	AFDB:Q9VEA2	0.335	0.374	4.741E-12	876	0.111	0.127	Q9VEA2.pdb.gz	Q9VEA2_DROME GH10703p OS=Drosophila melanogaster OX=7227 GN=Vps39 PE=2 SV=1
7	AFDB:Q9P6N4	0.296	0.323	5.381E-12	906	0.091	0.100	Q9P6N4.pdb.gz	PEP5_SCHPO E3 ubiquitin-protein ligase pep5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps11 PE=3 SV=1
8	AFDB:Q8L5Y0	0.290	0.290	6.107E-12	1000	0.103	0.103	Q8L5Y0.pdb.gz	VPS39_ARATH Vacuolar sorting protein 39 OS=Arabidopsis thaliana OX=3702 GN=VPS39 PE=1 SV=1
9	AFDB:Q9VRX2	0.270	0.233	9.314E-12	1229	0.121	0.098	Q9VRX2.pdb.gz	VPS8_DROME Vacuolar protein sorting-associated protein 8 homolog OS=Drosophila melanogaster OX=7227 GN=Vps8 PE=1 SV=1
10	AFDB:E7F590	0.206	0.237	1.546E-11	854	0.082	0.096	E7F590.pdb.gz	VPS41_DANRE Vacuolar protein sorting-associated protein 41 homolog OS=Danio rerio OX=7955 GN=vps41 PE=1 SV=1
11	PDB:7r5jT0	0.244	0.244	4.393E-9	1004	0.125	0.125	7r5jT0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:6qk7A	0.123	0.114	1.696E-8	1161	0.134	0.116	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
13	PDB:1xi4A	0.191	0.134	7.748E-8	1630	0.114	0.070	1xi4A.pdb.gz
14	PDB:7wooC	0.169	0.136	5.632E-7	1325	0.128	0.097	7wooC.pdb.gz
15	PDB:5a9qA	0.228	0.212	8.234E-7	1097	0.122	0.111	5a9qA.pdb.gz
16	PDB:7r5jD4	0.248	0.207	2.467E-6	1312	0.130	0.100	7r5jD4.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
17	PDB:7mqaLQ	0.144	0.170	3.315E-6	830	0.071	0.086	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
18	PDB:6r8yK	0.133	0.155	5.500E-6	825	0.068	0.082	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
19	PDB:7wb4j	0.196	0.197	6.512E-6	995	0.110	0.111	7wb4j.pdb.gz
20	PDB:7vciR	0.160	0.150	8.042E-6	1082	0.110	0.102	7vciR.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IZE2	0.0	924	1003	0.481	0.482	A0A0R4IZE2_DANRE HPS3 biogenesis of lysosomal organelles complex 2 subunit 1 OS=Danio rerio OX=7955 GN=zgc:152969 PE=4 SV=1
2	Q91VB4	0.0	1697	1002	0.810	0.811	HPS3_MOUSE BLOC-2 complex member HPS3 OS=Mus musculus OX=10090 GN=Hps3 PE=2 SV=2
3	Q969F9	0.0	2071	1004	1.000	1.000	HPS3_HUMAN BLOC-2 complex member HPS3 OS=Homo sapiens OX=9606 GN=HPS3 PE=1 SV=1
4	P48378	5.1	33.5	723	0.019	0.026	RFX2_HUMAN DNA-binding protein RFX2 OS=Homo sapiens OX=9606 GN=RFX2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14763 HPS3_C	1.3e-169	575.6	Hermansky-Pudlak syndrome 3, C-terminal
2	PF14762 HPS3_Mid	5e-172	583.6	Hermansky-Pudlak syndrome 3, middle region
3	PF14761 HPS3_N	6.1e-74	259.6	Hermansky-Pudlak syndrome 3
4	PF15278 Sec3_C_2	4.8e+02	12.5	Sec3 exocyst complex subunit

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296051

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265967	0.996	Hermansky-Pudlak syndrome 5 protein
2	9606.ENSP00000299238	0.992	Hermansky-Pudlak syndrome 6 protein
3	9606.ENSP00000381213	0.983	Hermansky-Pudlak syndrome 4 protein
4	9606.ENSP00000393840	0.955	Biogenesis of lysosome-related organelles complex 1 subunit 3
5	9606.ENSP00000341680	0.945	Dysbindin
6	9606.ENSP00000220531	0.943	Biogenesis of lysosome-related organelles complex 1 subunit 6
7	9606.ENSP00000326649	0.928	Hermansky-Pudlak syndrome 1 protein
8	9606.ENSP00000359398	0.892	Biogenesis of lysosome-related organelles complex 1 subunit 2
9	9606.ENSP00000447537	0.881	Biogenesis of lysosome-related organelles complex 1 subunit 1
10	9606.ENSP00000447650	0.877	Uncharacterized protein
11	9606.ENSP00000357674	0.851	SNARE-associated protein Snapin
12	9606.ENSP00000318128	0.819	Biogenesis of lysosome-related organelles complex 1 subunit 4
13	9606.ENSP00000380598	0.802	Biogenesis of lysosome-related organelles complex 1 subunit 5
14	9606.ENSP00000255194	0.750	AP-3 complex subunit beta-1
15	9606.ENSP00000222584	0.641	Transcription factor Sp4
16	9606.ENSP00000373570	0.627	5,6-dihydroxyindole-2-carboxylic acid oxidase
17	9606.ENSP00000345974	0.619	Mitochondrial enolase superfamily member 1
18	9606.ENSP00000363139	0.614	CD164 molecule like 2
19	9606.ENSP00000346659	0.606	P protein
20	9606.ENSP00000259050	0.600	E3 ubiquitin-protein ligase MARCH7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0043473	0.972	pigmentation
GO:0006996	0.894	organelle organization
GO:0065007	0.485	biological regulation
GO:0051179	0.432	localization
GO:0050789	0.416	regulation of biological process
GO:0050794	0.343	regulation of cellular process
GO:0051234	0.318	establishment of localization
GO:0006810	0.309	transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.997	cytoplasm
GO:0032991	0.964	protein-containing complex
GO:0140535	0.920	intracellular protein-containing complex
GO:0016020	0.903	membrane
GO:0043229	0.887	intracellular organelle
GO:0031082	0.873	BLOC complex
GO:0043231	0.873	intracellular membrane-bounded organelle
GO:0031982	0.864	vesicle
GO:0031410	0.818	cytoplasmic vesicle
GO:0005829	0.660	cytosol
GO:0012505	0.556	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]