StarFunc result for job id Q969G3

User Input

>input (411 residues)
MSKRPSYAPPPTPAPATQMPSTPGFVGYNPYSHLAYNNYRLGGNPGTNSRVTASSGITIP
KPPKPPDKPLMPYMRYSRKVWDQVKASNPDLKLWEIGKIIGGMWRDLTDEEKQEYLNEYE
AEKIEYNESMKAYHNSPAYLAYINAKSRAEAALEEESRQRQSRMEKGEPYMSIQPAEDPD
DYDDGFSMKHTATARFQRNHRLISEILSESVVPDVRSVVTTARMQVLKRQVQSLMVHQRK
LEAELLQIEERHQEKKRKFLESTDSFNNELKRLCGLKVEVDMEKIAAEIAQAEEQARKRQ
EEREKEAAEQAERSQSSIVPEEEQAANKGEEKKDDENIPMETEETHLEETTESQQNGEEG
TSTPEDKESGQEGVDSMAEEGTSDSNTGSESNSATVEEPPTDPIPEDEKKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1S7	0.317	0.317	1.454E-53	411	1.000	1.000	A0A024R1S7.pdb.gz
2	AFDB:Q803S1	0.274	0.269	3.117E-42	420	0.774	0.757	Q803S1.pdb.gz	Q803S1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Danio rerio OX=7955 GN=baf57 PE=1 SV=2
3	AFDB:Q9BIW6	0.235	0.132	3.155E-20	749	0.389	0.214	Q9BIW6.pdb.gz	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1
4	PDB:6lthQ	0.160	0.554	3.090E-9	105	0.255	1.000	6lthQ.pdb.gz	Structure of nucleosome-bound human BAF complex.
5	AFDB:Q9NP66	0.193	0.226	7.568E-5	347	0.139	0.164	Q9NP66.pdb.gz	HM20A_HUMAN High mobility group protein 20A OS=Homo sapiens OX=9606 GN=HMG20A PE=1 SV=1
6	AFDB:B7SBD2	0.197	0.150	1.022E-3	577	0.173	0.123	B7SBD2.pdb.gz	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
7	AFDB:P25976	0.140	0.082	2.245E-3	765	0.139	0.075	P25976.pdb.gz	UBF1_MOUSE Nucleolar transcription factor 1 OS=Mus musculus OX=10090 GN=Ubtf PE=1 SV=1
8	PDB:1j5nA	0.172	0.669	8.033E-3	93	0.068	0.301	1j5nA.pdb.gz	The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
9	AFDB:Q386P9	0.141	0.127	9.598E-3	461	0.156	0.139	Q386P9.pdb.gz	Q386P9_TRYB2 DUF4201 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0210 PE=4 SV=1
10	AFDB:Q9HG09	0.147	0.143	1.758E-2	425	0.134	0.129	Q9HG09.pdb.gz	PEX14_PICPA Peroxisomal membrane protein PEX14 OS=Komagataella pastoris OX=4922 GN=PEX14 PE=1 SV=1
11	AFDB:H2BJK0	0.143	0.113	1.868E-2	548	0.151	0.113	H2BJK0.pdb.gz	H2BJK0_STREE PspK OS=Streptococcus pneumoniae OX=1313 GN=pspK PE=4 SV=1
12	AFDB:Q7M6Z4	0.138	0.050	2.240E-2	1394	0.127	0.037	Q7M6Z4.pdb.gz	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
13	PDB:5lj5O	0.103	0.134	2.383E-1	283	0.105	0.152	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
14	PDB:7n6g3I	0.138	0.141	1.465	401	0.097	0.100	7n6g3I.pdb.gz	Cryo-EM structure of an active central apparatus.
15	PDB:5n9jV	0.077	0.247	1.556	99	0.046	0.192	5n9jV.pdb.gz
16	PDB:1lotA	0.071	0.067	1.654	436	0.019	0.018	1lotA.pdb.gz	Crystal structure of the complex between actin and human vitamin D-binding protein at 2.5 A resolution.
17	PDB:5mqfL	0.125	0.146	1.654	336	0.107	0.131	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
18	PDB:7sqkE	0.085	0.060	1.654	610	0.102	0.069	7sqkE.pdb.gz
19	PDB:5bw9g	0.115	0.233	1.983	141	0.029	0.085	5bw9g.pdb.gz
20	PDB:7sqcO1	0.139	0.092	2.378	673	0.100	0.061	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y4T4	0.0	674	335	0.815	1.000	A0A2R8Y4T4_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=1
2	A0A2R8YES3	0.0	686	347	0.830	0.983	A0A2R8YES3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=1
3	B4DGM3	0.0	806	393	0.956	1.000	B4DGM3_HUMAN SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=1
4	O54941	0.0	823	411	0.973	0.973	SMCE1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Mus musculus OX=10090 GN=Smarce1 PE=1 SV=1
5	Q56A18	0.0	683	376	0.844	0.923	SMCE1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Rattus norvegicus OX=10116 GN=Smarce1 PE=1 SV=1
6	Q803S1	0.0	514	420	0.762	0.745	Q803S1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Danio rerio OX=7955 GN=baf57 PE=1 SV=2
7	Q969G3	0.0	843	411	1.000	1.000	SMCE1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1 OS=Homo sapiens OX=9606 GN=SMARCE1 PE=1 SV=2
8	Q9W384	8.41e-76	252	749	0.355	0.195	Q9W384_DROME Brahma associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=1 SV=1
9	Q9BIW6	1.03e-75	251	749	0.355	0.195	Q9BIW6_DROME Brahma-associated protein 111kD OS=Drosophila melanogaster OX=7227 GN=Bap111 PE=2 SV=1
10	Q9P0W2	7.59e-10	62.0	317	0.073	0.095	HM20B_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
11	C9J8X5	9.34e-10	60.5	215	0.073	0.140	C9J8X5_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
12	Q9Z104	3.08e-09	60.1	317	0.073	0.095	HM20B_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related OS=Mus musculus OX=10090 GN=Hmg20b PE=1 SV=1
13	C9JQA7	4.28e-09	57.0	142	0.071	0.204	C9JQA7_HUMAN High mobility group 20B (Fragment) OS=Homo sapiens OX=9606 GN=HMG20B PE=1 SV=1
14	P11633	7.97e-09	55.1	99	0.071	0.293	NHP6B_YEAST Non-histone chromosomal protein 6B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NHP6B PE=1 SV=3
15	B4UN11	1.37e-08	54.3	93	0.071	0.312	B4UN11_CANGA Candida glabrata strain CBS138 chromosome H complete sequence OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0H08541g PE=4 SV=1
16	Q80W03	5.86e-08	57.0	575	0.066	0.047	TOX3_MOUSE TOX high mobility group box family member 3 OS=Mus musculus OX=10090 GN=Tox3 PE=1 SV=1
17	B7SBD2	5.87e-08	57.0	577	0.066	0.047	TOX3_RAT TOX high mobility group box family member 3 OS=Rattus norvegicus OX=10116 GN=Tox3 PE=1 SV=1
18	O15405	6.41e-08	57.0	576	0.066	0.047	TOX3_HUMAN TOX high mobility group box family member 3 OS=Homo sapiens OX=9606 GN=TOX3 PE=1 SV=2
19	P40630	8.66e-08	55.1	243	0.095	0.160	TFAM_MOUSE Transcription factor A, mitochondrial OS=Mus musculus OX=10090 GN=Tfam PE=1 SV=2
20	O94842	1.56e-07	55.8	621	0.063	0.042	TOX4_HUMAN TOX high mobility group box family member 4 OS=Homo sapiens OX=9606 GN=TOX4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06320 GCN5L1	14	17.3	GCN5-like protein 1 (GCN5L1)
2	PF00505 HMG_box	1.1e-14	65.9	HMG (high mobility group) box
3	PF09011 HMG_box_2	0.017	27.0	HMG-box domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323967

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254480	0.999	SWI/SNF complex subunit SMARCC1
2	9606.ENSP00000263121	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
3	9606.ENSP00000265773	0.999	Probable global transcription activator SNF2L2
4	9606.ENSP00000267064	0.999	SWI/SNF complex subunit SMARCC2
5	9606.ENSP00000320485	0.999	AT-rich interactive domain-containing protein 1A
6	9606.ENSP00000378414	0.999	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1
7	9606.ENSP00000395654	0.999	Transcription activator BRG1
8	9606.ENSP00000397552	0.999	Actin-like protein 6A
9	9606.ENSP00000262188	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 3
10	9606.ENSP00000392617	0.998	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2
11	9606.ENSP00000335044	0.997	AT-rich interactive domain-containing protein 2
12	9606.ENSP00000344546	0.997	AT-rich interactive domain-containing protein 1B
13	9606.ENSP00000378181	0.996	Bromodomain-containing protein 7
14	9606.ENSP00000378307	0.996	Protein polybromo-1
15	9606.ENSP00000436901	0.996	Zinc finger protein ubi-d4
16	9606.ENSP00000414516	0.995	Protein SSXT
17	9606.ENSP00000341805	0.992	PHD finger protein 10
18	9606.ENSP00000349960	0.992	Actin, cytoplasmic 1
19	9606.ENSP00000479526	0.989	Zinc finger protein DPF3
20	9606.ENSP00000347716	0.985	D4 zinc and double PHD fingers family 1 variant 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003676	0.997	nucleic acid binding
GO:0003677	0.985	DNA binding
GO:0140297	0.910	DNA-binding transcription factor binding
GO:0140110	0.856	transcription regulator activity
GO:0003824	0.553	catalytic activity
GO:0003682	0.528	chromatin binding
GO:0031490	0.390	chromatin DNA binding
GO:0061629	0.350	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0003712	0.342	transcription coregulator activity
GO:0031492	0.342	nucleosomal DNA binding
GO:0008080	0.310	N-acetyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0006355	0.985	regulation of DNA-templated transcription
GO:0048523	0.906	negative regulation of cellular process
GO:0071840	0.880	cellular component organization or biogenesis
GO:0016043	0.867	cellular component organization
GO:0032501	0.857	multicellular organismal process
GO:0010605	0.857	negative regulation of macromolecule metabolic process
GO:0032502	0.850	developmental process
GO:0010558	0.850	negative regulation of macromolecule biosynthetic process
GO:0031327	0.848	negative regulation of cellular biosynthetic process
GO:0048856	0.844	anatomical structure development
GO:0006325	0.815	chromatin organization
GO:0007275	0.813	multicellular organism development
GO:0051172	0.812	negative regulation of nitrogen compound metabolic process
GO:0045934	0.795	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.791	negative regulation of RNA metabolic process
GO:1903507	0.768	negative regulation of nucleic acid-templated transcription
GO:0007399	0.711	nervous system development
GO:0006357	0.698	regulation of transcription by RNA polymerase II
GO:0006338	0.664	chromatin remodeling
GO:0022411	0.659	cellular component disassembly
GO:0043933	0.642	protein-containing complex organization
GO:0048869	0.610	cellular developmental process
GO:0045892	0.607	negative regulation of DNA-templated transcription
GO:0030154	0.556	cell differentiation
GO:0048518	0.499	positive regulation of biological process
GO:0048522	0.465	positive regulation of cellular process
GO:0071824	0.437	protein-DNA complex subunit organization
GO:0034728	0.425	nucleosome organization
GO:0032984	0.371	protein-containing complex disassembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.968	protein-containing complex
GO:0043232	0.950	intracellular non-membrane-bounded organelle
GO:0005694	0.876	chromosome
GO:0000785	0.836	chromatin
GO:0140513	0.807	nuclear protein-containing complex
GO:1902494	0.804	catalytic complex
GO:0005737	0.598	cytoplasm
GO:1904949	0.575	ATPase complex
GO:0070603	0.559	SWI/SNF superfamily-type complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.3.1.-	0.313	Transferring groups other than amino-acyl groups.

[back to server]