StarFunc result for job id Q969G5

User Input

>input (261 residues)
MRESALERGPVPEAPAGGPVHAVTVVTLLEKLASMLETLRERQGGLARRQGGLAGSVRRI
QSGLGALSRSHDTTSNTLAQLLAKAERVSSHANAAQERAVRRAAQVQRLEANHGLLVARG
KLHVLLFKEEGEVPASAFQKAPEPLGPADQSELGPEQLEAEVGESSDEEPVESRAQRLRR
TGLQKVQSLRRALSGRKGPAAPPPTPVKPPRLGPGRSAEAQPEAQPALEPTLEPEPPQDT
EEDPGRPGAAEEALLQMESVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969G5	1.000	1.000	1.370E-36	261	1.000	1.000	Q969G5.pdb.gz	CAVN3_HUMAN Caveolae-associated protein 3 OS=Homo sapiens OX=9606 GN=CAVIN3 PE=1 SV=3
2	AFDB:Q9Z1H9	0.526	0.522	1.861E-27	263	0.835	0.829	Q9Z1H9.pdb.gz	CAVN3_RAT Caveolae-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Cavin3 PE=1 SV=1
3	AFDB:O54724	0.401	0.271	3.370E-5	392	0.272	0.181	O54724.pdb.gz	CAVN1_MOUSE Caveolae-associated protein 1 OS=Mus musculus OX=10090 GN=Cavin1 PE=1 SV=1
4	AFDB:A2AMM0	0.385	0.283	5.117E-5	362	0.253	0.182	A2AMM0.pdb.gz	CAVN4_MOUSE Caveolae-associated protein 4 OS=Mus musculus OX=10090 GN=Cavin4 PE=1 SV=1
5	AFDB:Q76P38	0.307	0.207	3.562E-2	398	0.161	0.106	Q76P38.pdb.gz	Q76P38_DICDI Lis-interacting protein OS=Dictyostelium discoideum OX=44689 GN=nudE PE=3 SV=1
6	AFDB:F7BMG3	0.208	0.134	6.667E-2	437	0.165	0.098	F7BMG3.pdb.gz	F7BMG3_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=2
7	AFDB:Q9VM65	0.242	0.208	1.248E-1	315	0.123	0.102	Q9VM65.pdb.gz	FGOP2_DROME FGFR1 oncogene partner 2 homolog OS=Drosophila melanogaster OX=7227 GN=Fgop2 PE=2 SV=1
8	AFDB:Q9A6M7	0.205	0.264	1.338E-1	194	0.176	0.237	Q9A6M7.pdb.gz	Q9A6M7_CAUVC PflI OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=pflI PE=4 SV=1
9	AFDB:Q0IGM5	0.335	0.287	1.434E-1	310	0.123	0.103	Q0IGM5.pdb.gz	Q0IGM5_ARATH At1g56080 OS=Arabidopsis thaliana OX=3702 GN=NAIP3 PE=1 SV=1
10	AFDB:Q38CJ2	0.357	0.138	1.434E-1	764	0.180	0.062	Q38CJ2.pdb.gz	Q38CJ2_TRYB2 Protein kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7860 PE=4 SV=1
11	PDB:5x3tA	0.072	0.215	5.219	70	0.057	0.214	5x3tA.pdb.gz
12	PDB:6nr7A	0.118	0.033	5.999	1086	0.050	0.012	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
13	PDB:7z36B	0.228	0.151	6.895	446	0.096	0.056	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
14	PDB:7egdF	0.083	0.062	7.393	412	0.077	0.049	7egdF.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969G5	2.42e-179	495	261	1.000	1.000	CAVN3_HUMAN Caveolae-associated protein 3 OS=Homo sapiens OX=9606 GN=CAVIN3 PE=1 SV=3
2	Q9Z1H9	2.77e-136	386	263	0.835	0.829	CAVN3_RAT Caveolae-associated protein 3 OS=Rattus norvegicus OX=10116 GN=Cavin3 PE=1 SV=1
3	Q91VJ2	3.41e-124	355	260	0.808	0.812	CAVN3_MOUSE Caveolae-associated protein 3 OS=Mus musculus OX=10090 GN=Cavin3 PE=1 SV=1
4	Q63918	3.94e-40	145	418	0.333	0.208	CAVN2_MOUSE Caveolae-associated protein 2 OS=Mus musculus OX=10090 GN=Cavin2 PE=1 SV=3
5	O95810	1.09e-39	144	425	0.333	0.205	CAVN2_HUMAN Caveolae-associated protein 2 OS=Homo sapiens OX=9606 GN=CAVIN2 PE=1 SV=3
6	Q66H98	4.06e-39	142	417	0.333	0.209	CAVN2_RAT Caveolae-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Cavin2 PE=1 SV=3
7	P85125	1.30e-21	94.7	392	0.249	0.166	CAVN1_RAT Caveolae-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Cavin1 PE=1 SV=1
8	O54724	1.51e-21	94.7	392	0.249	0.166	CAVN1_MOUSE Caveolae-associated protein 1 OS=Mus musculus OX=10090 GN=Cavin1 PE=1 SV=1
9	A6NA21	6.06e-21	93.6	454	0.234	0.134	A6NA21_DANRE Caveolae-associated protein 1b OS=Danio rerio OX=7955 GN=fd20g07 PE=1 SV=1
10	Q5BKX8	4.44e-19	87.4	364	0.188	0.135	CAVN4_HUMAN Caveolae-associated protein 4 OS=Homo sapiens OX=9606 GN=CAVIN4 PE=1 SV=2
11	Q6NZI2	6.01e-18	84.3	390	0.222	0.149	CAVN1_HUMAN Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1 PE=1 SV=1
12	A2AMM0	1.85e-17	82.8	362	0.192	0.138	CAVN4_MOUSE Caveolae-associated protein 4 OS=Mus musculus OX=10090 GN=Cavin4 PE=1 SV=1
13	Q5PQY9	2.46e-16	79.3	318	0.192	0.157	Q5PQY9_DANRE Muscle-related coiled-coil protein OS=Danio rerio OX=7955 GN=murc PE=1 SV=1
14	B1PRL5	4.06e-15	76.3	362	0.176	0.127	CAVN4_RAT Caveolae-associated protein 4 OS=Rattus norvegicus OX=10116 GN=Cavin4 PE=1 SV=1
15	E7F0K3	9.72e-12	66.6	415	0.207	0.130	E7F0K3_DANRE Caveolae-associated protein 1a OS=Danio rerio OX=7955 GN=cavin1a PE=3 SV=1
16	Q8IEU9	0.25	35.4	3346	0.126	0.010	Q8IEU9_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1300300 PE=4 SV=1
17	Q9UPW8	0.62	33.9	1703	0.084	0.013	UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens OX=9606 GN=UNC13A PE=2 SV=4
18	Q3UVX5	0.65	33.9	1203	0.130	0.028	GRM5_MOUSE Metabotropic glutamate receptor 5 OS=Mus musculus OX=10090 GN=Grm5 PE=1 SV=2
19	P9WGI1	1.6	32.3	528	0.061	0.030	SIGA_MYCTU RNA polymerase sigma factor SigA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=sigA PE=1 SV=1
20	P18183	2.8	31.6	511	0.061	0.031	SIGA_STRCO RNA polymerase principal sigma factor HrdB OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) OX=100226 GN=hrdB PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07966 A1_Propeptide	7.6e+02	11.5	A1 Propeptide
2	PF08614 ATG16	33	16.1	Autophagy protein 16 (ATG16)
3	PF20072 DUF6468	2.8e+02	13.1	Domain of unknown function (DUF6468)
4	PF15237 PTRF_SDPR	1.3e-34	131.5	PTRF/SDPR family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307292

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339191	0.965	Caveolin-1
2	9606.ENSP00000263277	0.720	EH domain-containing protein 2
3	9606.ENSP00000295050	0.680	SprT-like domain-containing protein Spartan
4	9606.ENSP00000301727	0.677	Transcription factor E4F1
5	9606.ENSP00000349259	0.672	Spectrin beta chain, non-erythrocytic 1
6	9606.ENSP00000222693	0.660	Caveolin-2
7	9606.ENSP00000325017	0.657	Condensin complex subunit 1
8	9606.ENSP00000263274	0.654	DNA ligase 1
9	9606.ENSP00000363017	0.653	Replication protein A 32 kDa subunit
10	9606.ENSP00000341940	0.651	Caveolin-3
11	9606.ENSP00000279242	0.644	Mitochondrial ribosomal protein L49
12	9606.ENSP00000414921	0.626	Polypyrimidine tract-binding protein 3
13	9606.ENSP00000377532	0.624	Pyruvate carboxylase, mitochondrial
14	9606.ENSP00000269141	0.618	Cadherin-2
15	9606.ENSP00000355955	0.618	Neudesin
16	9606.ENSP00000317331	0.615	Translocon-associated protein subunit delta
17	9606.ENSP00000216605	0.613	C-1-tetrahydrofolate synthase, cytoplasmic
18	9606.ENSP00000349541	0.610	Caveolae-associated protein 1
19	9606.ENSP00000438248	0.608	Calumenin
20	9606.ENSP00000472847	0.605	Serine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050794	0.986	regulation of cellular process
GO:0019222	0.979	regulation of metabolic process
GO:0009966	0.966	regulation of signal transduction
GO:1902531	0.918	regulation of intracellular signal transduction
GO:0060255	0.858	regulation of macromolecule metabolic process
GO:0048519	0.856	negative regulation of biological process
GO:0048518	0.854	positive regulation of biological process
GO:0071840	0.819	cellular component organization or biogenesis
GO:0016043	0.796	cellular component organization
GO:0048522	0.731	positive regulation of cellular process
GO:0048523	0.726	negative regulation of cellular process
GO:0031323	0.661	regulation of cellular metabolic process
GO:0010468	0.631	regulation of gene expression
GO:0070372	0.502	regulation of ERK1 and ERK2 cascade
GO:0007623	0.459	circadian rhythm
GO:0009968	0.452	negative regulation of signal transduction
GO:0006996	0.438	organelle organization
GO:0051896	0.433	regulation of protein kinase B signaling
GO:1902532	0.429	negative regulation of intracellular signal transduction
GO:0009892	0.428	negative regulation of metabolic process
GO:1902533	0.397	positive regulation of intracellular signal transduction
GO:0030029	0.360	actin filament-based process
GO:0031324	0.341	negative regulation of cellular metabolic process
GO:0007010	0.317	cytoskeleton organization
GO:0080090	0.303	regulation of primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005901	0.999	caveola
GO:0032991	0.985	protein-containing complex
GO:0005622	0.984	intracellular anatomical structure
GO:0005737	0.973	cytoplasm
GO:0043231	0.819	intracellular membrane-bounded organelle
GO:0070013	0.472	intracellular organelle lumen
GO:0005634	0.347	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]