StarFunc result for job id Q969H0

User Input

>input (707 residues)
MNQELLSVGSKRRRTGGSLRGNPSSSQVDEEQMNRVVEEEQQQQLRQQEEEHTARNGEVV
GVEPRPGGQNDSQQGQLEENNNRFISVDEDSSGNQEEQEEDEEHAGEQDEEDEEEEEMDQ
ESDDFDQSDDSSREDEHTHTNSVTNSSSIVDLPVHQLSSPFYTKTTKMKRKLDHGSEVRS
FSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQEWLKM
FQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSFLEPKD
LLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKVIKPGFIHSPWKSAYIRQHR
IDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAVTGKCLRTLVGH
TGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVVSGSRD
ATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLHTLQGH
TNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILVSGNAD
STVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNL
VTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P87060	0.514	0.472	3.622E-42	775	0.253	0.231	P87060.pdb.gz	POP1_SCHPO WD repeat-containing protein pop1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pop1 PE=1 SV=1
2	AFDB:A0A0S2Z507	0.413	0.453	1.977E-37	636	0.218	0.242	A0A0S2Z507.pdb.gz	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
3	AFDB:P87053	0.487	0.562	1.368E-36	605	0.207	0.241	P87053.pdb.gz	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
4	AFDB:Q5SRY7	0.409	0.516	5.834E-36	542	0.199	0.260	Q5SRY7.pdb.gz	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
5	AFDB:A0A2R8RWN9	0.408	0.520	1.378E-35	534	0.201	0.266	A0A2R8RWN9.pdb.gz	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
6	PDB:5mzhB	0.433	0.727	4.776E-31	415	0.156	0.265	5mzhB.pdb.gz
7	PDB:6ttuT	0.396	0.655	9.101E-31	394	0.174	0.312	6ttuT.pdb.gz	NEDD8 nucleates a multivalent cullin-RING-UBE2D ubiquitin ligation assembly.
8	AFDB:P90648	0.337	0.326	2.203E-30	732	0.151	0.146	P90648.pdb.gz	MHCKB_DICDI Myosin heavy chain kinase B OS=Dictyostelium discoideum OX=44689 GN=mhkB PE=1 SV=1
9	PDB:4v7fq	0.434	0.686	4.323E-30	443	0.133	0.212	4v7fq.pdb.gz	60S ribosome biogenesis requires rotation of the 5S ribonucleoprotein particle.
10	PDB:5nnzA	0.424	0.874	1.535E-25	335	0.141	0.299	5nnzA.pdb.gz
11	PDB:7bt6x	0.425	0.609	5.006E-25	488	0.123	0.178	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
12	PDB:5jcsq	0.426	0.612	9.040E-25	488	0.124	0.180	5jcsq.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
13	PDB:7z8bF	0.473	0.704	4.781E-24	457	0.127	0.197	7z8bF.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
14	PDB:1vyhC	0.347	0.739	1.130E-23	310	0.146	0.332	1vyhC.pdb.gz
15	PDB:2h9lA	0.336	0.692	1.327E-23	321	0.133	0.293	2h9lA.pdb.gz
16	PDB:7mq8LR	0.343	0.316	2.186E-21	773	0.112	0.102	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	AFDB:Q8H0T9	0.348	0.296	3.001E-18	837	0.096	0.081	Q8H0T9.pdb.gz	KTN84_ARATH Katanin p80 WD40 repeat-containing subunit B1 homolog KTN80.4 OS=Arabidopsis thaliana OX=3702 GN=KTN80.4 PE=1 SV=3
18	AFDB:Q64LD2	0.324	0.412	3.749E-17	544	0.137	0.178	Q64LD2.pdb.gz	WDR25_HUMAN WD repeat-containing protein 25 OS=Homo sapiens OX=9606 GN=WDR25 PE=1 SV=3
19	AFDB:Q5JSH3	0.346	0.274	8.857E-17	913	0.185	0.143	Q5JSH3.pdb.gz	WDR44_HUMAN WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1
20	AFDB:O48847	0.318	0.288	2.093E-16	787	0.133	0.119	O48847.pdb.gz	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B7ZDC8	0.0	1056	544	0.726	0.943	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
2	Q0VGT7	0.0	555	347	0.433	0.882	Q0VGT7_MOUSE Fbxw7 protein OS=Mus musculus OX=10090 GN=Fbxw7 PE=2 SV=1
3	Q8VBV4	0.0	1411	710	0.965	0.961	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
4	Q969H0	0.0	1463	707	1.000	1.000	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
5	Q9VZF4	0.0	810	1326	0.537	0.287	FBXW7_DROME F-box/WD repeat-containing protein 7 OS=Drosophila melanogaster OX=7227 GN=ago PE=1 SV=1
6	Q93794	1.33e-155	464	587	0.352	0.424	SEL10_CAEEL F-box/WD repeat-containing protein sel-10 OS=Caenorhabditis elegans OX=6239 GN=sel-10 PE=1 SV=3
7	Q5A9A6	3.80e-72	251	768	0.229	0.211	Q5A9A6_CANAL SCF ubiquitin ligase complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC4 PE=4 SV=1
8	A0A2R8QFQ6	8.07e-69	237	562	0.197	0.247	FB11A_DANRE F-box and WD repeat domain-containing 11-A OS=Danio rerio OX=7955 GN=fbxw11a PE=2 SV=1
9	Q9UKB1	3.43e-68	235	542	0.197	0.256	FBW1B_HUMAN F-box/WD repeat-containing protein 11 OS=Homo sapiens OX=9606 GN=FBXW11 PE=1 SV=1
10	Q5SRY7	4.58e-68	235	542	0.197	0.256	FBW1B_MOUSE F-box/WD repeat-containing protein 11 OS=Mus musculus OX=10090 GN=Fbxw11 PE=1 SV=1
11	P87053	6.07e-68	236	605	0.215	0.251	POF1_SCHPO F-box/WD repeat-containing protein pof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pof1 PE=1 SV=1
12	A0A2R8RWN9	7.66e-68	234	534	0.205	0.272	FB11B_DANRE F-box and WD repeat domain-containing 11-B OS=Danio rerio OX=7955 GN=fbxw11b PE=2 SV=1
13	Q09990	1.02e-67	237	665	0.225	0.239	LIN23_CAEEL F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2
14	Q91854	2.85e-67	232	518	0.202	0.276	TRCB_XENLA Beta-TrCP OS=Xenopus laevis OX=8355 GN=fbxw1 PE=1 SV=1
15	Q9Y297	4.02e-66	231	605	0.202	0.236	FBW1A_HUMAN F-box/WD repeat-containing protein 1A OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
16	B7Z3H4	4.68e-66	230	579	0.202	0.247	B7Z3H4_HUMAN Beta-transducin repeat containing E3 ubiquitin protein ligase OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
17	A0A0S2Z507	5.01e-66	231	636	0.202	0.225	A0A0S2Z507_HUMAN Beta-transducin repeat containing isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=BTRC PE=1 SV=1
18	Q3ULA2	7.49e-66	230	605	0.201	0.235	FBW1A_MOUSE F-box/WD repeat-containing protein 1A OS=Mus musculus OX=10090 GN=Btrc PE=1 SV=2
19	P39014	8.10e-65	228	640	0.198	0.219	MET30_YEAST F-box protein MET30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MET30 PE=1 SV=1
20	P07834	3.43e-64	229	779	0.211	0.191	CDC4_YEAST Cell division control protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	2.5e-11	55.1	Anaphase-promoting complex subunit 4 WD40 domain
2	PF03498 CDtoxinA	4.7	18.2	Cytolethal distending toxin A/C domain
3	PF08662 eIF2A	2.6	19.4	Eukaryotic translation initiation factor eIF2A
4	PF00646 F-box	0.00018	32.5	F-box domain
5	PF12937 F-box-like	1.3e-09	49.1	F-box-like
6	PF16529 Ge1_WD40	0.26	21.8	WD40 region of Ge1, enhancer of mRNA-decapping protein
7	PF07569 Hira	26	15.9	TUP1-like enhancer of split
8	PF03547 Mem_trans	2e+02	11.8	Membrane transport protein
9	PF20426 NBCH_WD40	1.7e-07	42.0	Neurobeachin beta propeller domain
10	PF11715 Nup160	2e-12	58.3	Nucleoporin Nup120/160
11	PF16756 PALB2_WD40	17	15.8	Partner and localizer of BRCA2 WD40 domain
12	PF13360 PQQ_2	0.61	21.2	PQQ-like domain
13	PF00400 WD40	1.5e-45	163.4	WD domain, G-beta repeat
14	PF17005 WD40_like	2.1	19.2	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000281708

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000216225	0.999	E3 ubiquitin-protein ligase RBX1
2	9606.ENSP00000231487	0.999	S-phase kinase-associated protein 1
3	9606.ENSP00000262643	0.999	G1/S-specific cyclin-E1
4	9606.ENSP00000326804	0.999	Cullin-1
5	9606.ENSP00000479618	0.999	Myc proto-oncogene protein
6	9606.ENSP00000277541	0.998	Neurogenic locus notch homolog protein 1
7	9606.ENSP00000215574	0.997	Ubiquitin-conjugating enzyme E2 R1
8	9606.ENSP00000360266	0.991	Transcription factor AP-1
9	9606.ENSP00000433488	0.989	Friend leukemia integration 1 transcription factor
10	9606.ENSP00000358022	0.984	Induced myeloid leukemia cell differentiation protein Mcl-1
11	9606.ENSP00000209728	0.979	Cell division control protein 6 homolog
12	9606.ENSP00000388107	0.975	Ubiquitin-60S ribosomal protein L40
13	9606.ENSP00000274255	0.972	S-phase kinase-associated protein 2
14	9606.ENSP00000003302	0.963	Ubiquitin carboxyl-terminal hydrolase 28
15	9606.ENSP00000364163	0.956	Neurogenic locus notch homolog protein 4
16	9606.ENSP00000264731	0.953	Tumor protein 63
17	9606.ENSP00000351490	0.941	Protein max
18	9606.ENSP00000359206	0.933	F-box/WD repeat-containing protein 1A
19	9606.ENSP00000348069	0.931	Sterol regulatory element-binding protein 1
20	9606.ENSP00000324806	0.917	Glycogen synthase kinase-3 beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.890	catalytic activity
GO:0140096	0.878	catalytic activity, acting on a protein
GO:0016740	0.861	transferase activity
GO:0019787	0.807	ubiquitin-like protein transferase activity
GO:0004842	0.782	ubiquitin-protein transferase activity
GO:0019899	0.729	enzyme binding
GO:0060090	0.727	molecular adaptor activity
GO:0030674	0.645	protein-macromolecule adaptor activity
GO:0061630	0.590	ubiquitin protein ligase activity
GO:0042802	0.552	identical protein binding
GO:1901363	0.463	heterocyclic compound binding
GO:0097159	0.463	organic cyclic compound binding
GO:0003676	0.416	nucleic acid binding
GO:0030332	0.391	cyclin binding
GO:0051219	0.381	phosphoprotein binding
GO:0097027	0.380	ubiquitin-protein transferase activator activity
GO:0045309	0.373	protein phosphorylated amino acid binding
GO:0031625	0.316	ubiquitin protein ligase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.986	cellular process
GO:0071704	0.983	organic substance metabolic process
GO:0044238	0.976	primary metabolic process
GO:0006807	0.959	nitrogen compound metabolic process
GO:0048856	0.956	anatomical structure development
GO:0044237	0.947	cellular metabolic process
GO:0043170	0.943	macromolecule metabolic process
GO:0048519	0.942	negative regulation of biological process
GO:0048583	0.941	regulation of response to stimulus
GO:0032501	0.928	multicellular organismal process
GO:0051603	0.905	proteolysis involved in protein catabolic process
GO:0043161	0.904	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0007275	0.883	multicellular organism development
GO:0048518	0.867	positive regulation of biological process
GO:0051171	0.859	regulation of nitrogen compound metabolic process
GO:0031323	0.859	regulation of cellular metabolic process
GO:0080090	0.854	regulation of primary metabolic process
GO:0060255	0.852	regulation of macromolecule metabolic process
GO:0048731	0.817	system development
GO:0031146	0.805	SCF-dependent proteasomal ubiquitin-dependent protein catabolic process
GO:0001944	0.790	vasculature development
GO:0050896	0.781	response to stimulus
GO:0048522	0.769	positive regulation of cellular process
GO:0048523	0.759	negative regulation of cellular process
GO:0023051	0.748	regulation of signaling
GO:0009893	0.705	positive regulation of metabolic process
GO:0010604	0.701	positive regulation of macromolecule metabolic process
GO:0010646	0.696	regulation of cell communication
GO:0051716	0.598	cellular response to stimulus
GO:0051173	0.596	positive regulation of nitrogen compound metabolic process
GO:0009966	0.527	regulation of signal transduction
GO:0031325	0.473	positive regulation of cellular metabolic process
GO:0051246	0.451	regulation of protein metabolic process
GO:0009889	0.446	regulation of biosynthetic process
GO:0031326	0.439	regulation of cellular biosynthetic process
GO:0036211	0.425	protein modification process
GO:0019219	0.405	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.388	regulation of gene expression
GO:0009892	0.377	negative regulation of metabolic process
GO:0071840	0.341	cellular component organization or biogenesis
GO:0010556	0.341	regulation of macromolecule biosynthetic process
GO:0051247	0.324	positive regulation of protein metabolic process
GO:0007154	0.323	cell communication
GO:0023052	0.321	signaling
GO:1902531	0.307	regulation of intracellular signal transduction
GO:0007165	0.305	signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0031981	0.999	nuclear lumen
GO:0005654	0.994	nucleoplasm
GO:0140535	0.992	intracellular protein-containing complex
GO:1990234	0.992	transferase complex
GO:0005829	0.991	cytosol
GO:0043232	0.983	intracellular non-membrane-bounded organelle
GO:0000151	0.955	ubiquitin ligase complex
GO:0012505	0.948	endomembrane system
GO:0031461	0.948	cullin-RING ubiquitin ligase complex
GO:0019005	0.873	SCF ubiquitin ligase complex
GO:0005730	0.635	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.861	Transferases.

[back to server]