StarFunc result for job id Q969J2

User Input

>input (545 residues)
MAREPRKNAALDAQSAEDQTGLLTVKVEKEEASALTAEVRAPCSPARGPERSRQRFRGFR
YPEAAGPREALSRLRELCGQWLQPEMHSKEQILELLVLEQFLTILPGNLQSWVREQHPES
GEEVVVLLEYLERQLDEPAPQVPVGDQGQELLCCKMALLTQTQGSQSSQCQPMKALFKHE
SLGSQPLHDRVLQVPGLAQGGCCREDAMVASRLTPGSQGLLKMEDVALTLTPGWTQLDSS
QVNLYRDEKQENHSSLVSLGGEIQTKSRDLPPVKKLPEKEHGKICHLREDIAQIPTHAEA
GEQEGRLQRKQKNAIGSRRHYCHECGKSFAQSSGLTKHRRIHTGEKPYECEDCGKTFIGS
SALVIHQRVHTGEKPYECEECGKVFSHSSNLIKHQRTHTGEKPYECDDCGKTFSQSCSLL
EHHKIHTGEKPYQCNMCGKAFRRNSHLLRHQRIHGDKNVQNPEHGESWESQGRTESQWEN
TEAPVSYKCNECERSFTRNRSLIEHQKIHTGEKPYQCDTCGKGFTRTSYLVQHQRSHVGK
KTLSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0S2Z658	0.269	0.269	1.546E-75	545	1.000	1.000	A0A0S2Z658.pdb.gz	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
2	AFDB:Q9BRR0	0.265	0.268	7.054E-65	538	0.842	0.853	Q9BRR0.pdb.gz	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
3	AFDB:Q9P0L1	0.327	0.244	2.601E-37	754	0.417	0.301	Q9P0L1.pdb.gz	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
4	AFDB:Q86W11	0.328	0.359	3.649E-37	494	0.407	0.449	Q86W11.pdb.gz	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
5	AFDB:O43309	0.260	0.235	5.119E-37	604	0.411	0.371	O43309.pdb.gz	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
6	AFDB:Q8NF99	0.274	0.279	1.066E-36	534	0.406	0.414	Q8NF99.pdb.gz	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
7	AFDB:Q15776	0.259	0.245	1.582E-36	578	0.461	0.434	Q15776.pdb.gz	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
8	AFDB:Q3ZBY5	0.300	0.343	4.173E-35	466	0.385	0.451	Q3ZBY5.pdb.gz	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
9	AFDB:Q9Y5A6	0.279	0.314	1.290E-34	473	0.393	0.452	Q9Y5A6.pdb.gz	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
10	AFDB:P10073	0.321	0.352	2.842E-34	491	0.363	0.403	P10073.pdb.gz	ZSC22_HUMAN Zinc finger and SCAN domain-containing protein 22 OS=Homo sapiens OX=9606 GN=ZSCAN22 PE=1 SV=2
11	PDB:3w5kB	0.090	0.271	1.282E-4	110	0.075	0.373	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6hlqI	0.030	0.119	1.877	111	0.037	0.180	6hlqI.pdb.gz	The cryo-EM structure of a 12-subunit variant of RNA polymerase I reveals dissociation of the A49-A34.5 heterodimer and rearrangement of subunit A12.2.
13	PDB:8escS	0.058	0.093	1.986	268	0.046	0.093	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
14	PDB:3javA	0.075	0.033	2.223	2327	0.127	0.030	3javA.pdb.gz
15	PDB:5dkaA	0.057	0.249	2.223	96	0.028	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
16	PDB:7uhyA	0.050	0.040	2.633	771	0.039	0.027	7uhyA.pdb.gz	Structure of the nutrient-sensing hub GATOR2.
17	PDB:5n5yI	0.031	0.134	2.947	99	0.039	0.212	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
18	PDB:7o4iW	0.050	0.072	2.947	312	0.057	0.099	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:7pksh	0.074	0.051	3.299	887	0.029	0.018	7pksh.pdb.gz	Structural basis of Integrator-mediated transcription regulation.
20	PDB:4c2mI	0.039	0.111	5.181	124	0.033	0.145	4c2mI.pdb.gz	RNA Polymerase I Structure and Transcription Regulation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0S2Z658	0.0	1123	545	1.000	1.000	A0A0S2Z658_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=2 SV=1
2	Q969J2	0.0	1123	545	1.000	1.000	ZKSC4_HUMAN Zinc finger protein with KRAB and SCAN domains 4 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
3	Q9BRR0	0.0	913	538	0.844	0.855	ZKSC3_HUMAN Zinc finger protein with KRAB and SCAN domains 3 OS=Homo sapiens OX=9606 GN=ZKSCAN3 PE=1 SV=2
4	Q15776	6.71e-144	429	578	0.457	0.431	ZKSC8_HUMAN Zinc finger protein with KRAB and SCAN domains 8 OS=Homo sapiens OX=9606 GN=ZKSCAN8 PE=1 SV=2
5	O43309	9.54e-123	375	611	0.440	0.393	ZSC12_HUMAN Zinc finger and SCAN domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ZSCAN12 PE=1 SV=2
6	Q8NF99	2.83e-120	366	534	0.415	0.423	ZN397_HUMAN Zinc finger protein 397 OS=Homo sapiens OX=9606 GN=ZNF397 PE=1 SV=2
7	P17029	1.48e-119	365	563	0.428	0.414	ZKSC1_HUMAN Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3
8	Q86W11	1.11e-117	358	494	0.422	0.466	ZSC30_HUMAN Zinc finger and SCAN domain-containing protein 30 OS=Homo sapiens OX=9606 GN=ZSCAN30 PE=1 SV=1
9	Q9P0L1	8.11e-115	359	754	0.439	0.317	ZKSC7_HUMAN Zinc finger protein with KRAB and SCAN domains 7 OS=Homo sapiens OX=9606 GN=ZKSCAN7 PE=1 SV=2
10	Q9Y5A6	6.14e-113	345	473	0.400	0.461	ZSC21_HUMAN Zinc finger and SCAN domain-containing protein 21 OS=Homo sapiens OX=9606 GN=ZSCAN21 PE=1 SV=2
11	Q9Y2L8	2.67e-112	355	839	0.437	0.284	ZKSC5_HUMAN Zinc finger protein with KRAB and SCAN domains 5 OS=Homo sapiens OX=9606 GN=ZKSCAN5 PE=1 SV=1
12	Q07231	2.21e-109	339	555	0.385	0.378	ZSC21_MOUSE Zinc finger and SCAN domain-containing protein 21 OS=Mus musculus OX=10090 GN=Zscan21 PE=2 SV=2
13	Q3ZBY5	2.96e-109	336	466	0.396	0.464	Q3ZBY5_BOVIN Zinc finger and SCAN domain containing 21 OS=Bos taurus OX=9913 GN=ZSCAN21 PE=2 SV=1
14	O14978	4.42e-100	318	683	0.429	0.343	ZN263_HUMAN Zinc finger protein 263 OS=Homo sapiens OX=9606 GN=ZNF263 PE=1 SV=2
15	P49910	4.90e-100	313	485	0.402	0.452	ZN165_HUMAN Zinc finger protein 165 OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
16	Q53Z40	4.90e-100	313	485	0.402	0.452	Q53Z40_HUMAN HCG1 protein OS=Homo sapiens OX=9606 GN=ZNF165 PE=1 SV=1
17	Q8CF60	4.67e-98	313	680	0.398	0.319	ZN263_MOUSE Zinc finger protein 263 OS=Mus musculus OX=10090 GN=Znf263 PE=1 SV=1
18	A0A0S2Z6X0	7.31e-95	287	149	0.261	0.953	A0A0S2Z6X0_HUMAN Zinc finger with KRAB and SCAN domains 4 isoform 3 OS=Homo sapiens OX=9606 GN=ZKSCAN4 PE=1 SV=1
19	O95125	8.55e-95	304	648	0.420	0.353	ZN202_HUMAN Zinc finger protein 202 OS=Homo sapiens OX=9606 GN=ZNF202 PE=1 SV=4
20	Q96LW9	2.74e-93	292	406	0.350	0.470	ZSC31_HUMAN Zinc finger and SCAN domain-containing protein 31 OS=Homo sapiens OX=9606 GN=ZSCAN31 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08394 Arc_trans_TRASH	3.4e+02	13.0	Archaeal TRASH domain
2	PF07975 C1_4	1.2e+02	14.4	TFIIH C1-like domain
3	PF01363 FYVE	1.7e+02	13.7	FYVE zinc finger
4	PF01155 HypA	2.1e+02	13.4	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
5	PF01352 KRAB	1.4e-05	35.9	KRAB box
6	PF02023 SCAN	1.6e-38	141.7	SCAN domain
7	PF01286 XPA_N	0.018	26.4	XPA protein N-terminal
8	PF01428 zf-AN1	71	15.0	AN1-like Zinc finger
9	PF00096 zf-C2H2	3.3e-41	148.6	Zinc finger, C2H2 type
10	PF16622 zf-C2H2_11	0.79	20.8	zinc-finger C2H2-type
11	PF13894 zf-C2H2_4	2.4e-20	82.5	C2H2-type zinc finger
12	PF13912 zf-C2H2_6	0.00012	33.3	C2H2-type zinc finger
13	PF15909 zf-C2H2_8	4	19.2	C2H2-type zinc ribbon
14	PF12171 zf-C2H2_jaz	3.5e-08	44.8	Zinc-finger double-stranded RNA-binding
15	PF13913 zf-C2HC_2	1.3e+02	13.9	zinc-finger of a C2HC-type
16	PF13465 zf-H2C2_2	1.7e-45	162.7	Zinc-finger double domain
17	PF12874 zf-met	0.0005	31.6	Zinc-finger of C2H2 type
18	PF18439 zf_UBZ	0.026	25.5	Ubiquitin-Binding Zinc Finger
19	PF17032 zinc_ribbon_15	5.2	19.2	zinc-ribbon family
20	PF09723 Zn-ribbon_8	0.00084	30.7	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000366509

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380057	0.873	Zinc finger and SCAN domain-containing protein 32
2	9606.ENSP00000292450	0.861	Zinc finger and SCAN domain-containing protein 21
3	9606.ENSP00000338860	0.850	Zinc finger protein 444
4	9606.ENSP00000302310	0.833	Zinc finger protein 396
5	9606.ENSP00000363103	0.827	SCAN domain-containing protein 1
6	9606.ENSP00000261332	0.786	Zinc finger protein 24
7	9606.ENSP00000331577	0.786	Zinc finger protein 397
8	9606.ENSP00000259883	0.758	PiggyBac transposable element-derived protein 1
9	9606.ENSP00000472802	0.748	Zinc finger protein 446
10	9606.ENSP00000345716	0.741	NKAP-like protein
11	9606.ENSP00000355053	0.733	Zinc finger and SCAN domain-containing protein 20
12	9606.ENSP00000273320	0.702	Zinc finger protein with KRAB and SCAN domains 7
13	9606.ENSP00000294753	0.700	Zinc finger protein 496
14	9606.ENSP00000380087	0.700	Zinc finger protein 213
15	9606.ENSP00000395259	0.696	SCAN domain-containing protein 3
16	9606.ENSP00000268655	0.693	Zinc finger protein 174
17	9606.ENSP00000366465	0.686	Zinc finger protein with KRAB and SCAN domains 3
18	9606.ENSP00000311679	0.679	Zinc finger protein 483
19	9606.ENSP00000332750	0.634	Zinc finger protein with KRAB and SCAN domains 8
20	9606.ENSP00000250076	0.626	Zinc finger protein 232

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003690	0.867	double-stranded DNA binding
GO:1990837	0.763	sequence-specific double-stranded DNA binding
GO:0042802	0.508	identical protein binding
GO:0140110	0.342	transcription regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006355	0.998	regulation of DNA-templated transcription
GO:0048522	0.981	positive regulation of cellular process
GO:0048519	0.971	negative regulation of biological process
GO:0048523	0.962	negative regulation of cellular process
GO:0010605	0.955	negative regulation of macromolecule metabolic process
GO:0010604	0.943	positive regulation of macromolecule metabolic process
GO:0031325	0.911	positive regulation of cellular metabolic process
GO:0051173	0.904	positive regulation of nitrogen compound metabolic process
GO:0010557	0.899	positive regulation of macromolecule biosynthetic process
GO:0045893	0.886	positive regulation of DNA-templated transcription
GO:0031324	0.865	negative regulation of cellular metabolic process
GO:0051172	0.857	negative regulation of nitrogen compound metabolic process
GO:0045892	0.849	negative regulation of DNA-templated transcription
GO:0006357	0.837	regulation of transcription by RNA polymerase II
GO:0009987	0.541	cellular process
GO:0000122	0.417	negative regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005737	0.703	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]