StarFunc result for job id Q969K3

User Input

>input (372 residues)
MKAGATSMWASCCGLLNEVMGTGAVRGQQSAFAGATGPFRFTPNPEFSTYPPAATEGPNI
VCKACGLSFSVFRKKHVCCDCKKDFCSVCSVLQENLRRCSTCHLLQETAFQRPQLMRLKV
KDLRQYLILRNIPIDTCREKEDLVDLVLCHHGLGSEDDMDTSSLNSSRSQTSSFFTRSFF
SNYTAPSATMSSFQGELMDGDQTSRSGVPAQVQSEITSANTEDDDDDDDEDDDDEEENAE
DRNPGLSKERVRASLSDLSSLDDVEGMSVRQLKEILARNFVNYSGCCEKWELVEKVNRLY
KENEENQKSYGERLQLQDEEDDSLCRICMDAVIDCVLLECGHMVTCTKCGKRMSECPICR
QYVVRAVHVFKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6AYH3	0.300	0.294	2.046E-57	381	0.876	0.856	Q6AYH3.pdb.gz	RNF34_RAT E3 ubiquitin-protein ligase RNF34 OS=Rattus norvegicus OX=10116 GN=Rnf34 PE=1 SV=1
2	AFDB:H7BYJ1	0.358	0.269	4.488E-53	507	0.949	0.696	H7BYJ1.pdb.gz	H7BYJ1_HUMAN Ring finger protein 34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
3	AFDB:Q6ZQM0	0.302	0.299	3.374E-32	377	0.438	0.432	Q6ZQM0.pdb.gz	RFFL_MOUSE E3 ubiquitin-protein ligase rififylin OS=Mus musculus OX=10090 GN=Rffl PE=1 SV=1
4	AFDB:O59722	0.139	0.030	1.574E-2	1932	0.134	0.026	O59722.pdb.gz	FAB1_SCHPO 1-phosphatidylinositol 3-phosphate 5-kinase fab1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fab1 PE=1 SV=2
5	AFDB:Q69Z36	0.129	0.080	5.623E-2	601	0.151	0.093	Q69Z36.pdb.gz	MEX3B_MOUSE RNA-binding protein MEX3B OS=Mus musculus OX=10090 GN=Mex3b PE=2 SV=2
6	AFDB:Q947D2	0.117	0.042	7.254E-2	1103	0.126	0.043	Q947D2.pdb.gz	PRAF1_ARATH PH, RCC1 and FYVE domains-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=PRAF1 PE=1 SV=1
7	AFDB:M9PE32	0.116	0.037	8.780E-2	1314	0.132	0.037	M9PE32.pdb.gz	M9PE32_DROME Fife, isoform D OS=Drosophila melanogaster OX=7227 GN=Fife PE=1 SV=1
8	AFDB:E7FBG0	0.091	0.078	1.660E-1	445	0.113	0.094	E7FBG0.pdb.gz
9	AFDB:P32917	0.092	0.046	2.141E-1	917	0.113	0.046	P32917.pdb.gz	STE5_YEAST Protein STE5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=STE5 PE=1 SV=2
10	AFDB:Q04116	0.084	0.086	2.592E-1	353	0.097	0.102	Q04116.pdb.gz	YHP1_YEAST Homeobox protein YHP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YHP1 PE=1 SV=1
11	PDB:1b8tA	0.080	0.147	3.713E-1	192	0.048	0.094	1b8tA.pdb.gz	Solution structure of the chicken cysteine-rich protein, CRP1, a double-LIM protein implicated in muscle differentiation.
12	PDB:5gm6a	0.110	0.304	8.494E-1	123	0.038	0.114	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:4r8pL	0.102	0.146	1.168	254	0.043	0.063	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
14	PDB:1zbuB	0.111	0.134	1.507	304	0.024	0.030	1zbuB.pdb.gz	Structural basis for 3'-end specific recognition of histone mRNA stem-loop by 3'-exonuclease, a human nuclease that also targets siRNA
15	PDB:3fkiL	0.086	0.466	2.507	47	0.013	0.106	3fkiL.pdb.gz	Structure of the 12-Subunit RNA Polymerase II Refined with the Aid of Anomalous Diffraction Data
16	PDB:7ddeA	0.106	0.079	2.672	525	0.030	0.021	7ddeA.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
17	PDB:4kfzB	0.064	0.120	3.447	148	0.030	0.074	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
18	PDB:1b71A	0.105	0.180	3.915	191	0.035	0.068	1b71A.pdb.gz	Alternative metal-binding sites in rubrerythrin.
19	PDB:1imlA	0.044	0.171	3.915	76	0.016	0.079	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
20	PDB:7dvqM	0.091	0.168	3.915	191	0.043	0.084	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7BYJ1	0.0	733	507	0.949	0.696	H7BYJ1_HUMAN Ring finger protein 34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
2	Q6AYH3	0.0	620	381	0.879	0.858	RNF34_RAT E3 ubiquitin-protein ligase RNF34 OS=Rattus norvegicus OX=10116 GN=Rnf34 PE=1 SV=1
3	Q969K3	0.0	770	372	1.000	1.000	RNF34_HUMAN E3 ubiquitin-protein ligase RNF34 OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
4	Q99KR6	0.0	624	376	0.887	0.878	RNF34_MOUSE E3 ubiquitin-protein ligase RNF34 OS=Mus musculus OX=10090 GN=Rnf34 PE=1 SV=1
5	G3V504	9.62e-120	345	163	0.438	1.000	G3V504_HUMAN Ring finger protein 34 (Fragment) OS=Homo sapiens OX=9606 GN=RNF34 PE=1 SV=1
6	Q8WZ73	9.66e-90	276	363	0.452	0.463	RFFL_HUMAN E3 ubiquitin-protein ligase rififylin OS=Homo sapiens OX=9606 GN=RFFL PE=1 SV=1
7	Q6ZQM0	9.94e-90	276	377	0.446	0.440	RFFL_MOUSE E3 ubiquitin-protein ligase rififylin OS=Mus musculus OX=10090 GN=Rffl PE=1 SV=1
8	A1Z971	1.76e-33	133	700	0.185	0.099	A1Z971_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=dRNF34 PE=1 SV=1
9	Q557E7	1.46e-10	65.1	665	0.070	0.039	CBLA_DICDI E3 ubiquitin-protein ligase cblA OS=Dictyostelium discoideum OX=44689 GN=cblA-1 PE=1 SV=1
10	Q969V5	1.03e-08	58.5	352	0.113	0.119	MUL1_HUMAN Mitochondrial ubiquitin ligase activator of NFKB 1 OS=Homo sapiens OX=9606 GN=MUL1 PE=1 SV=1
11	Q8JHV9	1.94e-08	57.8	401	0.056	0.052	BIR7A_XENLA Baculoviral IAP repeat-containing protein 7-A OS=Xenopus laevis OX=8355 GN=birc7-a PE=1 SV=1
12	Q6PIA0	3.65e-08	55.8	236	0.075	0.119	Q6PIA0_HUMAN Baculoviral IAP repeat-containing 8 OS=Homo sapiens OX=9606 GN=BIRC8 PE=1 SV=1
13	Q60989	3.79e-08	57.4	496	0.065	0.048	XIAP_MOUSE E3 ubiquitin-protein ligase XIAP OS=Mus musculus OX=10090 GN=Xiap PE=1 SV=2
14	P98170	4.08e-08	57.0	497	0.065	0.048	XIAP_HUMAN E3 ubiquitin-protein ligase XIAP OS=Homo sapiens OX=9606 GN=XIAP PE=1 SV=2
15	O08863	8.07e-08	56.2	600	0.056	0.035	BIRC3_MOUSE Baculoviral IAP repeat-containing protein 3 OS=Mus musculus OX=10090 GN=Birc3 PE=1 SV=2
16	H0YZU0	8.46e-08	56.2	485	0.075	0.058	H0YZU0_TAEGU X-linked inhibitor of apoptosis OS=Taeniopygia guttata OX=59729 GN=XIAP PE=3 SV=2
17	Q13490	1.13e-07	55.8	618	0.056	0.034	BIRC2_HUMAN Baculoviral IAP repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=BIRC2 PE=1 SV=2
18	Q5XIW4	1.16e-07	55.8	602	0.056	0.035	Q5XIW4_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=2 SV=1
19	A0A0G2JTI9	1.17e-07	55.8	638	0.056	0.033	A0A0G2JTI9_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=1
20	F7FLN8	1.19e-07	55.8	602	0.056	0.035	F7FLN8_RAT Baculoviral IAP repeat-containing 3 OS=Rattus norvegicus OX=10116 GN=Birc3 PE=3 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10208 ARMET_C	0.35	21.7	ARMET, C-terminal
2	PF12949 HeH	1.4e+02	13.6	HeH/LEM domain
3	PF14447 Prok-RING_4	1.5	20.1	Prokaryotic RING finger family 4
4	PF02037 SAP	5.5	18.1	SAP domain
5	PF04615 Utp14	2e+02	12.0	Utp14 protein
6	PF13923 zf-C3HC4_2	10	17.4	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	5.6e-08	43.8	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000376258

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000269305	0.930	Cellular tumor antigen p53
2	9606.ENSP00000430955	0.724	E3 ubiquitin ligase that catalyzes the direct transfer of ubiquitin from E2 ubiquitin-conjugating enzyme to a specific substrate. In response to bacterial infection, negatively regulates the phagocyte oxidative burst by controlling the turnover of the NADPH oxidase complex subunits. Promotes monoubiquitination of CYBA and 'Lys-48'- linked polyubiquitination and degradation of CYBB NADPH oxidase catalytic subunits, both essential for the generation of antimicrobial reactive oxygen species. Involved in the maintenance of cholesterol homeostasis. In response to high sterol concentrations [...]
3	9606.ENSP00000424497	0.714	Putative E3 ubiquitin-protein ligase SH3RF2
4	9606.ENSP00000262375	0.672	DnaJ homolog subfamily A member 3, mitochondrial
5	9606.ENSP00000356985	0.643	Death effector domain-containing protein
6	9606.ENSP00000269391	0.636	E3 ubiquitin ligase RNF157
7	9606.ENSP00000336994	0.636	Cleft lip and palate transmembrane protein 1
8	9606.ENSP00000388107	0.635	Ubiquitin-60S ribosomal protein L40
9	9606.ENSP00000378199	0.622	Heat shock-related 70 kDa protein 2
10	9606.ENSP00000259939	0.612	E3 ubiquitin-protein ligase RNF144B
11	9606.ENSP00000344942	0.602	Protein unc-119 homolog B
12	9606.ENSP00000272317	0.600	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000304697	0.600	Polyubiquitin-B
14	9606.ENSP00000441543	0.600	Polyubiquitin-C
15	9606.ENSP00000217740	0.593	E3 ubiquitin-protein ligase RNF125
16	9606.ENSP00000398523	0.585	Calcium-binding and coiled-coil domain-containing protein 2
17	9606.ENSP00000351813	0.556	E3 ubiquitin-protein ligase MARCH5
18	9606.ENSP00000217173	0.555	RING finger protein 37
19	9606.ENSP00000257575	0.536	Ring finger protein, transmembrane 2
20	9606.ENSP00000323304	0.528	Leucine rich single-pass membrane protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0061630	0.998	ubiquitin protein ligase activity
GO:0005515	0.993	protein binding
GO:0019899	0.606	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0010498	0.990	proteasomal protein catabolic process
GO:0006511	0.989	ubiquitin-dependent protein catabolic process
GO:0050789	0.986	regulation of biological process
GO:0019222	0.981	regulation of metabolic process
GO:0009966	0.976	regulation of signal transduction
GO:0016567	0.974	protein ubiquitination
GO:0050896	0.971	response to stimulus
GO:1902531	0.970	regulation of intracellular signal transduction
GO:0051716	0.963	cellular response to stimulus
GO:0043161	0.960	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0043066	0.959	negative regulation of apoptotic process
GO:0043281	0.958	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:2000117	0.928	negative regulation of cysteine-type endopeptidase activity
GO:0043154	0.924	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:2001233	0.919	regulation of apoptotic signaling pathway
GO:0009968	0.902	negative regulation of signal transduction
GO:1901796	0.859	regulation of signal transduction by p53 class mediator
GO:2001234	0.856	negative regulation of apoptotic signaling pathway
GO:2001236	0.738	regulation of extrinsic apoptotic signaling pathway
GO:1902532	0.735	negative regulation of intracellular signal transduction
GO:1901797	0.633	negative regulation of signal transduction by p53 class mediator
GO:1902041	0.591	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:2001237	0.584	negative regulation of extrinsic apoptotic signaling pathway
GO:0000209	0.508	protein polyubiquitination
GO:0007154	0.425	cell communication
GO:0031323	0.419	regulation of cellular metabolic process
GO:0070936	0.396	protein K48-linked ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0016020	0.998	membrane
GO:0005886	0.986	plasma membrane
GO:0016604	0.936	nuclear body
GO:0005829	0.578	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.998	Transferases.

[back to server]