StarFunc result for job id Q969L4

User Input

>input (123 residues)
MAVSHSVKERTISENSLIILLQGLQGRVTTVDLRDESVAHGRIDNVDAFMNIRLAKVTYT
DRWGHQVKLDDLFVTGRNVRYVHIPDDVNITSTIEQQLQIIHRVRNFGGKGQGRWEFPPK
NCK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969L4	1.000	1.000	1.065E-24	123	1.000	1.000	Q969L4.pdb.gz	LSM10_HUMAN U7 snRNA-associated Sm-like protein LSm10 OS=Homo sapiens OX=9606 GN=LSM10 PE=1 SV=1
2	AFDB:Q8QZX5	0.849	0.856	1.576E-21	122	0.886	0.893	Q8QZX5.pdb.gz	LSM10_MOUSE U7 snRNA-associated Sm-like protein LSm10 OS=Mus musculus OX=10090 GN=Lsm10 PE=1 SV=1
3	AFDB:F1Q940	0.863	0.806	1.361E-18	132	0.683	0.636	F1Q940.pdb.gz
4	PDB:6v4xC	0.835	0.899	1.721E-18	114	0.927	1.000	6v4xC.pdb.gz	Structure of an active human histone pre-mRNA 3'-end processing machinery.
5	AFDB:A1Z8C4	0.752	0.665	2.495E-10	141	0.244	0.213	A1Z8C4.pdb.gz	A1Z8C4_DROME Lsm10 OS=Drosophila melanogaster OX=7227 GN=Lsm10 PE=4 SV=1
6	AFDB:O14352	0.593	0.602	3.685E-9	121	0.260	0.264	O14352.pdb.gz	LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm4 PE=1 SV=1
7	AFDB:Q4Q2F6	0.610	0.661	9.041E-9	113	0.195	0.212	Q4Q2F6.pdb.gz	Q4Q2F6_LEIMA Small nuclear ribonucleoprotein Sm D3 OS=Leishmania major OX=5664 GN=LMJF_34_3860 PE=3 SV=1
8	AFDB:P43321	0.569	0.689	1.082E-8	101	0.187	0.228	P43321.pdb.gz	SMD3_YEAST Small nuclear ribonucleoprotein Sm D3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMD3 PE=1 SV=1
9	AFDB:Q17348	0.572	0.518	1.082E-8	136	0.203	0.184	Q17348.pdb.gz	SMD3_CAEEL Small nuclear ribonucleoprotein Sm D3 OS=Caenorhabditis elegans OX=6239 GN=snr-1 PE=2 SV=2
10	AFDB:B0V1I0	0.584	0.567	1.295E-8	127	0.203	0.197	B0V1I0.pdb.gz
11	AFDB:F4K4E3	0.599	0.573	1.295E-8	129	0.203	0.194	F4K4E3.pdb.gz	LSM4_ARATH Sm-like protein LSM4 OS=Arabidopsis thaliana OX=3702 GN=LSM4 PE=1 SV=1
12	PDB:5nrll	0.625	0.769	3.355E-8	99	0.187	0.232	5nrll.pdb.gz	Structure of a pre-catalytic spliceosome.
13	PDB:6ppnD	0.585	0.804	6.480E-8	88	0.211	0.295	6ppnD.pdb.gz	Molecular basis for the distinct cellular functions of the Lsm1-7 and Lsm2-8 complexes.
14	PDB:3pgwW	0.555	0.730	9.278E-8	92	0.154	0.207	3pgwW.pdb.gz
15	PDB:3jb9D	0.549	0.696	1.590E-7	96	0.179	0.229	3jb9D.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
16	PDB:3jcr4	0.561	0.846	2.276E-7	80	0.171	0.263	3jcr4.pdb.gz
17	PDB:6g90d	0.569	0.747	2.276E-7	93	0.187	0.247	6g90d.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:3jcrp	0.606	0.783	4.396E-7	94	0.211	0.277	3jcrp.pdb.gz
19	PDB:3jb9F	0.610	0.901	5.929E-7	82	0.179	0.268	3jb9F.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
20	PDB:4c92B	0.520	0.600	8.490E-7	105	0.154	0.181	4c92B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969L4	6.99e-89	255	123	1.000	1.000	LSM10_HUMAN U7 snRNA-associated Sm-like protein LSm10 OS=Homo sapiens OX=9606 GN=LSM10 PE=1 SV=1
2	Q8QZX5	1.01e-76	224	122	0.886	0.893	LSM10_MOUSE U7 snRNA-associated Sm-like protein LSm10 OS=Mus musculus OX=10090 GN=Lsm10 PE=1 SV=1
3	Q9SY09	1.28e-09	53.9	116	0.236	0.250	SMD1B_ARATH Small nuclear ribonucleoprotein SmD1b OS=Arabidopsis thaliana OX=3702 GN=SMD1B PE=3 SV=1
4	Q4Q2F6	5.56e-09	52.0	113	0.195	0.212	Q4Q2F6_LEIMA Small nuclear ribonucleoprotein Sm D3 OS=Leishmania major OX=5664 GN=LMJF_34_3860 PE=3 SV=1
5	Q9SSF1	6.88e-09	52.0	114	0.220	0.237	SMD1A_ARATH Small nuclear ribonucleoprotein SmD1a OS=Arabidopsis thaliana OX=3702 GN=SMD1A PE=3 SV=1
6	A1Z8C4	1.62e-08	51.6	141	0.276	0.241	A1Z8C4_DROME Lsm10 OS=Drosophila melanogaster OX=7227 GN=Lsm10 PE=4 SV=1
7	O14352	1.47e-07	48.5	121	0.211	0.215	LSM4_SCHPO Probable U6 snRNA-associated Sm-like protein LSm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm4 PE=1 SV=1
8	Q9VTW6	2.99e-07	47.4	95	0.171	0.221	Q9VTW6_DROME U6 snRNA-associated Sm-like protein LSm2 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10418 PE=1 SV=1
9	O35900	3.48e-07	47.0	95	0.171	0.221	LSM2_MOUSE U6 snRNA-associated Sm-like protein LSm2 OS=Mus musculus OX=10090 GN=Lsm2 PE=1 SV=1
10	Q9Y333	3.48e-07	47.0	95	0.171	0.221	LSM2_HUMAN U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens OX=9606 GN=LSM2 PE=1 SV=1
11	P62314	1.61e-06	45.8	119	0.195	0.202	SMD1_HUMAN Small nuclear ribonucleoprotein Sm D1 OS=Homo sapiens OX=9606 GN=SNRPD1 PE=1 SV=1
12	P62315	1.61e-06	45.8	119	0.195	0.202	SMD1_MOUSE Small nuclear ribonucleoprotein Sm D1 OS=Mus musculus OX=10090 GN=Snrpd1 PE=1 SV=1
13	Q1H595	2.23e-06	45.1	93	0.179	0.237	LSM2_ARATH Sm-like protein LSM2 OS=Arabidopsis thaliana OX=3702 GN=LSM2 PE=1 SV=1
14	O42661	2.29e-06	45.4	117	0.179	0.188	SMD1_SCHPO Small nuclear ribonucleoprotein Sm D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smd1 PE=1 SV=1
15	O94408	2.69e-06	44.7	96	0.163	0.208	LSM2_SCHPO U6 snRNA-associated Sm-like protein LSm2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=lsm2 PE=1 SV=1
16	F4K4E3	3.49e-06	45.1	129	0.171	0.163	LSM4_ARATH Sm-like protein LSM4 OS=Arabidopsis thaliana OX=3702 GN=LSM4 PE=1 SV=1
17	Q8JHH1	4.05e-06	44.7	119	0.187	0.193	Q8JHH1_DANRE Small nuclear ribonucleoprotein Sm D1 OS=Danio rerio OX=7955 GN=CHUNP6882 PE=1 SV=1
18	Q10013	7.13e-06	44.3	126	0.195	0.190	SMD1_CAEEL Probable small nuclear ribonucleoprotein Sm D1 OS=Caenorhabditis elegans OX=6239 GN=snr-3 PE=3 SV=1
19	Q9VU02	1.43e-05	43.5	124	0.195	0.194	SMD1_DROME Probable small nuclear ribonucleoprotein Sm D1 OS=Drosophila melanogaster OX=7227 GN=SmD1 PE=1 SV=1
20	Q9UUC6	1.67e-05	42.7	97	0.163	0.206	SMD3_SCHPO Small nuclear ribonucleoprotein Sm D3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=smd3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17726 DpnI_C	4.1e+02	12.5	Dam-replacing HTH domain
2	PF01423 LSM	1.9e-08	45.2	LSM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000319341

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215829	0.999	Small nuclear ribonucleoprotein Sm D3
2	9606.ENSP00000266735	0.999	Small nuclear ribonucleoprotein F
3	9606.ENSP00000272348	0.999	Small nuclear ribonucleoprotein G
4	9606.ENSP00000400591	0.999	Small nuclear ribonucleoprotein E
5	9606.ENSP00000412566	0.998	Small nuclear ribonucleoprotein-associated proteins B and B
6	9606.ENSP00000286307	0.997	U7 snRNA-associated Sm-like protein LSm11
7	9606.ENSP00000342374	0.972	Small nuclear ribonucleoprotein Sm D2
8	9606.ENSP00000417686	0.963	Histone RNA hairpin-binding protein
9	9606.ENSP00000261973	0.960	RNA-binding protein 25
10	9606.ENSP00000302160	0.959	U6 snRNA-associated Sm-like protein LSm3
11	9606.ENSP00000238112	0.951	Cleavage and polyadenylation specificity factor subunit 3
12	9606.ENSP00000245934	0.951	Symplekin
13	9606.ENSP00000249299	0.947	U6 snRNA-associated Sm-like protein LSm8
14	9606.ENSP00000448073	0.944	Pre-mRNA-processing factor 40 homolog B
15	9606.ENSP00000298875	0.923	Cleavage and polyadenylation specificity factor subunit 2
16	9606.ENSP00000364813	0.916	U6 snRNA-associated Sm-like protein LSm2
17	9606.ENSP00000364289	0.913	Nuclear cap-binding protein subunit 1
18	9606.ENSP00000326806	0.905	Nuclear cap-binding protein subunit 2
19	9606.ENSP00000472808	0.894	Zinc finger protein 473
20	9606.ENSP00000469468	0.875	U6 snRNA-associated Sm-like protein LSm4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0017069	0.998	snRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.958	biological regulation
GO:0050789	0.953	regulation of biological process
GO:0009987	0.903	cellular process
GO:0050794	0.851	regulation of cellular process
GO:0048518	0.804	positive regulation of biological process
GO:0048522	0.713	positive regulation of cellular process
GO:1902806	0.628	regulation of cell cycle G1/S phase transition
GO:0071704	0.611	organic substance metabolic process
GO:0045787	0.609	positive regulation of cell cycle
GO:1901990	0.608	regulation of mitotic cell cycle phase transition
GO:0045931	0.599	positive regulation of mitotic cell cycle
GO:0044238	0.584	primary metabolic process
GO:0044237	0.584	cellular metabolic process
GO:0090068	0.583	positive regulation of cell cycle process
GO:0006397	0.562	mRNA processing
GO:0008380	0.560	RNA splicing
GO:2000045	0.516	regulation of G1/S transition of mitotic cell cycle
GO:1901989	0.487	positive regulation of cell cycle phase transition
GO:1901992	0.484	positive regulation of mitotic cell cycle phase transition
GO:0000375	0.475	RNA splicing, via transesterification reactions
GO:1902808	0.465	positive regulation of cell cycle G1/S phase transition
GO:0000398	0.465	mRNA splicing, via spliceosome
GO:1900087	0.364	positive regulation of G1/S transition of mitotic cell cycle
GO:0071840	0.359	cellular component organization or biogenesis
GO:0016043	0.311	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990904	1.000	ribonucleoprotein complex
GO:0005654	0.999	nucleoplasm
GO:0120114	0.998	Sm-like protein family complex
GO:0140513	0.973	nuclear protein-containing complex
GO:0030532	0.939	small nuclear ribonucleoprotein complex
GO:0016604	0.888	nuclear body
GO:0005681	0.877	spliceosomal complex
GO:0005737	0.649	cytoplasm
GO:0015030	0.537	Cajal body
GO:0005829	0.397	cytosol
GO:0097525	0.317	spliceosomal snRNP complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]