StarFunc result for job id Q969M1

User Input

>input (308 residues)
MGNTLGLAPMGTLPRRSPRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHF
QVAHTIHMSALGLPGYHLHAAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLR
AKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSLTHRLVLGG
ELVYHRRPGEEGAILTLAGKYSAVHWVATLNVGSGGAHASYYHRANEQVQVGVEFEANTR
LQDTTFSFGYHLTLPQANMVFRGLVDSNWCVGAVLEKKMPPLPVTLALGAFLNHWRNRFH
CGFSITVG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4F267	0.974	0.974	7.919E-48	308	0.971	0.971	A4F267.pdb.gz	TM40L_RAT Mitochondrial import receptor subunit TOM40B OS=Rattus norvegicus OX=10116 GN=Tomm40l PE=1 SV=1
2	AFDB:O96008	0.912	0.780	2.161E-36	361	0.607	0.518	O96008.pdb.gz	TOM40_HUMAN Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1
3	PDB:7cp9I	0.911	0.980	9.859E-32	286	0.597	0.643	7cp9I.pdb.gz
4	AFDB:A1Z6L1	0.920	0.835	8.289E-30	340	0.432	0.391	A1Z6L1.pdb.gz	TO402_DROME Mitochondrial import receptor subunit TOM40 homolog 2 OS=Drosophila melanogaster OX=7227 GN=tomboy40 PE=2 SV=1
5	AFDB:Q9U4L6	0.925	0.829	1.258E-29	344	0.416	0.372	Q9U4L6.pdb.gz	TO401_DROME Mitochondrial import receptor subunit TOM40 homolog 1 OS=Drosophila melanogaster OX=7227 GN=Tom40 PE=2 SV=2
6	AFDB:Q18090	0.905	0.925	2.063E-27	301	0.399	0.409	Q18090.pdb.gz	TOM40_CAEEL Mitochondrial import receptor subunit TOM40 homolog OS=Caenorhabditis elegans OX=6239 GN=tomm-40 PE=2 SV=1
7	AFDB:Q9LHE5	0.808	0.805	1.238E-18	309	0.269	0.269	Q9LHE5.pdb.gz	TO401_ARATH Mitochondrial import receptor subunit TOM40-1 OS=Arabidopsis thaliana OX=3702 GN=TOM40-1 PE=1 SV=3
8	AFDB:P24391	0.841	0.745	2.262E-18	349	0.247	0.218	P24391.pdb.gz	TOM40_NEUCR Mitochondrial import receptor subunit tom40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=tom40 PE=1 SV=1
9	AFDB:Q5AH14	0.841	0.669	4.534E-18	390	0.247	0.195	Q5AH14.pdb.gz	Q5AH14_CANAL Tom40p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOM40 PE=3 SV=1
10	AFDB:P23644	0.828	0.663	2.640E-17	387	0.231	0.183	P23644.pdb.gz	TOM40_YEAST Mitochondrial import receptor subunit TOM40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM40 PE=1 SV=1
11	PDB:6ucva	0.835	0.812	9.852E-17	317	0.231	0.224	6ucva.pdb.gz
12	AFDB:O13656	0.825	0.741	2.333E-16	344	0.240	0.215	O13656.pdb.gz	TOM40_SCHPO Probable mitochondrial import receptor subunit tom40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tom40 PE=3 SV=3
13	PDB:5o8oA	0.760	0.708	1.975E-13	332	0.253	0.235	5o8oA.pdb.gz
14	PDB:4bumX	0.740	0.799	3.720E-11	283	0.140	0.152	4bumX.pdb.gz
15	PDB:5xdoB	0.674	0.793	2.413E-9	258	0.146	0.174	5xdoB.pdb.gz
16	PDB:2jk4A	0.732	0.778	9.848E-8	288	0.127	0.135	2jk4A.pdb.gz
17	PDB:4azlA	0.428	0.329	2.004E-3	418	0.107	0.079	4azlA.pdb.gz	A Conformational Landscape for Alginate Secretion Across the Outer Membrane of Pseudomonas Aeruginosa.
18	PDB:6bpnA	0.341	0.173	7.689E-3	656	0.107	0.050	6bpnA.pdb.gz	The structure of the bacterial iron-catecholate transporter Fiu suggests that it imports substrates via a two-step mechanism.
19	PDB:7acgA	0.410	0.297	1.405E-2	457	0.120	0.081	7acgA.pdb.gz	9.8 MAG. A new host lipid for in meso (lipid cubic phase) crystallization of integral membrane proteins
20	PDB:2gufA	0.332	0.205	1.855E-2	551	0.101	0.056	2gufA.pdb.gz	In Meso Structure of the Cobalamin Transporter, BtuB, at 1.95 A Resolution.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4F267	0.0	619	308	0.971	0.971	TM40L_RAT Mitochondrial import receptor subunit TOM40B OS=Rattus norvegicus OX=10116 GN=Tomm40l PE=1 SV=1
2	Q969M1	0.0	637	308	1.000	1.000	TM40L_HUMAN Mitochondrial import receptor subunit TOM40B OS=Homo sapiens OX=9606 GN=TOMM40L PE=1 SV=1
3	Q9CZR3	0.0	624	308	0.977	0.977	TM40L_MOUSE Mitochondrial import receptor subunit TOM40B OS=Mus musculus OX=10090 GN=Tomm40l PE=1 SV=1
4	O96008	3.98e-133	384	361	0.597	0.510	TOM40_HUMAN Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1
5	Q9QYA2	7.46e-129	373	361	0.581	0.496	TOM40_MOUSE Mitochondrial import receptor subunit TOM40 homolog OS=Mus musculus OX=10090 GN=Tomm40 PE=1 SV=3
6	Q75Q40	2.22e-128	372	361	0.578	0.493	TOM40_RAT Mitochondrial import receptor subunit TOM40 homolog OS=Rattus norvegicus OX=10116 GN=Tomm40 PE=1 SV=1
7	A1Z6L1	1.69e-90	275	340	0.429	0.388	TO402_DROME Mitochondrial import receptor subunit TOM40 homolog 2 OS=Drosophila melanogaster OX=7227 GN=tomboy40 PE=2 SV=1
8	Q9U4L6	4.76e-88	268	344	0.409	0.366	TO401_DROME Mitochondrial import receptor subunit TOM40 homolog 1 OS=Drosophila melanogaster OX=7227 GN=Tom40 PE=2 SV=2
9	Q18090	2.97e-71	224	301	0.393	0.402	TOM40_CAEEL Mitochondrial import receptor subunit TOM40 homolog OS=Caenorhabditis elegans OX=6239 GN=tomm-40 PE=2 SV=1
10	K7EJ57	2.21e-58	188	214	0.276	0.397	K7EJ57_HUMAN Translocase of outer mitochondrial membrane 40 (Fragment) OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=8
11	Q9LHE5	1.02e-27	111	309	0.286	0.285	TO401_ARATH Mitochondrial import receptor subunit TOM40-1 OS=Arabidopsis thaliana OX=3702 GN=TOM40-1 PE=1 SV=3
12	P24391	1.15e-21	95.5	349	0.279	0.246	TOM40_NEUCR Mitochondrial import receptor subunit tom40 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=tom40 PE=1 SV=1
13	Q5AH14	2.43e-20	92.4	390	0.240	0.190	Q5AH14_CANAL Tom40p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=TOM40 PE=3 SV=1
14	P23644	4.08e-17	83.2	387	0.273	0.217	TOM40_YEAST Mitochondrial import receptor subunit TOM40 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM40 PE=1 SV=1
15	O13656	1.70e-15	78.2	344	0.253	0.227	TOM40_SCHPO Probable mitochondrial import receptor subunit tom40 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tom40 PE=3 SV=3
16	O59010	0.53	34.3	425	0.091	0.066	GLT_PYRHO Glutamate transporter homolog OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=PH1295 PE=1 SV=1
17	P51907	3.6	31.6	523	0.084	0.050	EAA3_RAT Excitatory amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc1a1 PE=1 SV=1
18	P51906	4.3	31.6	523	0.071	0.042	EAA3_MOUSE Excitatory amino acid transporter 3 OS=Mus musculus OX=10090 GN=Slc1a1 PE=1 SV=2
19	F2YI08	5.2	31.2	798	0.084	0.033	F2YI08_CHIKV NsP2 protein (Fragment) OS=Chikungunya virus OX=37124 PE=4 SV=1
20	A4L7I2	5.8	31.2	2474	0.084	0.011	A4L7I2_CHIKV Polyprotein P1234 OS=Chikungunya virus OX=37124 GN=CHIKVgp1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01459 Porin_3	5.4e-64	227.9	Eukaryotic porin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017345

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003292	0.983	Translocase of outer mitochondrial membrane 70 homolog A (S. cerevisiae)
2	61853.ENSNLEP00000016089	0.981	Translocase of outer mitochondrial membrane 20 homolog (yeast)-like
3	61853.ENSNLEP00000018409	0.976	Translocase of outer mitochondrial membrane 22 homolog (yeast)
4	61853.ENSNLEP00000002069	0.965	Translocase of outer mitochondrial membrane 40 homolog (yeast)
5	61853.ENSNLEP00000019148	0.958	SAMM50 sorting and assembly machinery component
6	61853.ENSNLEP00000016889	0.957	Uncharacterized protein
7	61853.ENSNLEP00000017438	0.942	Translocase of inner mitochondrial membrane 50 homolog (S. cerevisiae)
8	61853.ENSNLEP00000009642	0.900	Translocase of inner mitochondrial membrane 17 homolog B (yeast)
9	61853.ENSNLEP00000014511	0.882	Metaxin 1
10	61853.ENSNLEP00000015669	0.881	Uncharacterized protein
11	61853.ENSNLEP00000021973	0.849	Mitochondrial import inner membrane translocase subunit TIM17
12	61853.ENSNLEP00000015672	0.846	Voltage-dependent anion channel 3
13	61853.ENSNLEP00000020494	0.846	Voltage-dependent anion channel 2
14	61853.ENSNLEP00000005896	0.834	Translocase of outer mitochondrial membrane 6 homolog (yeast)
15	61853.ENSNLEP00000000702	0.833	Uncharacterized protein
16	61853.ENSNLEP00000023611	0.831	Prohibitin
17	61853.ENSNLEP00000017900	0.823	OXA1L, mitochondrial inner membrane protein
18	61853.ENSNLEP00000004302	0.822	Superoxide dismutase [Cu-Zn]
19	61853.ENSNLEP00000019403	0.810	Mitochondrial import inner membrane translocase subunit TIM23
20	61853.ENSNLEP00000006959	0.808	Mitofusin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0033218	0.996	amide binding
GO:0005048	0.991	signal sequence binding
GO:0022857	0.936	transmembrane transporter activity
GO:0022884	0.901	macromolecule transmembrane transporter activity
GO:0140318	0.899	protein transporter activity
GO:0008320	0.894	protein transmembrane transporter activity
GO:0070678	0.567	preprotein binding
GO:0022803	0.421	passive transmembrane transporter activity
GO:0015267	0.411	channel activity
GO:0015075	0.367	monoatomic ion transmembrane transporter activity
GO:0005216	0.337	monoatomic ion channel activity
GO:0030943	0.319	mitochondrion targeting sequence binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0006839	0.991	mitochondrial transport
GO:0071702	0.987	organic substance transport
GO:0071705	0.986	nitrogen compound transport
GO:0071840	0.985	cellular component organization or biogenesis
GO:0016043	0.983	cellular component organization
GO:0015031	0.973	protein transport
GO:0070585	0.971	protein localization to mitochondrion
GO:0007005	0.956	mitochondrion organization
GO:0006886	0.945	intracellular protein transport
GO:0072594	0.944	establishment of protein localization to organelle
GO:0006605	0.938	protein targeting
GO:0072655	0.925	establishment of protein localization to mitochondrion
GO:0006626	0.833	protein targeting to mitochondrion
GO:0065007	0.458	biological regulation
GO:0050789	0.420	regulation of biological process
GO:0050794	0.362	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	1.000	protein-containing complex
GO:0005739	1.000	mitochondrion
GO:0016020	0.994	membrane
GO:0031090	0.951	organelle membrane
GO:0098798	0.932	mitochondrial protein-containing complex
GO:0031966	0.918	mitochondrial membrane
GO:0098796	0.877	membrane protein complex
GO:0098588	0.827	bounding membrane of organelle
GO:0019867	0.825	outer membrane
GO:0031968	0.817	organelle outer membrane
GO:0005741	0.812	mitochondrial outer membrane
GO:0070013	0.416	intracellular organelle lumen
GO:0005742	0.396	mitochondrial outer membrane translocase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]