StarFunc result for job id Q969N2

User Input

>input (578 residues)
MAAAMPLALLVLLLLGPGGWCLAEPPRDSLREELVITPLPSGDVAATFQFRTRWDSELQR
EGVSHYRLFPKALGQLISKYSLRELHLSFTQGFWRTRYWGPPFLQAPSGAELWVWFQDTV
TDVDKSWKELSNVLSGIFCASLNFIDSTNTVTPTASFKPLGLANDTDHYFLRYAVLPREV
VCTENLTPWKKLLPCSSKAGLSVLLKADRLFHTSYHSQAVHIRPVCRNARCTSISWELRQ
TLSVVFDAFITGQGKKDWSLFRMFSRTLTEPCPLASESRVYVDITTYNQDNETLEVHPPP
TTTYQDVILGTRKTYAIYDLLDTAMINNSRNLNIQLKWKRPPENEAPPVPFLHAQRYVSG
YGLQKGELSTLLYNTHPYRAFPVLLLDTVPWYLRLYVHTLTITSKGKENKPSYIHYQPAQ
DRLQPHLLEMLIQLPANSVTKVSIQFERALLKWTEYTPDPNHGFYVSPSVLSALVPSMVA
AKPVDWEESPLFNSLFPVSDGSNYFVRLYTEPLLVNLPTPDFSMPYNVICLTCTVVAVCY
GSFYNLLTRTFHIEEPRTGGLAKRLANLIRRARGVPPL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BXQ2	0.956	0.950	0.000	582	0.938	0.931	Q8BXQ2.pdb.gz	PIGT_MOUSE GPI transamidase component PIG-T OS=Mus musculus OX=10090 GN=Pigt PE=1 SV=2
2	PDB:7w72T	0.844	0.925	1.910E-94	527	0.910	0.998	7w72T.pdb.gz	Structure of human glycosylphosphatidylinositol transamidase.
3	AFDB:E9QH65	0.906	0.828	3.262E-93	633	0.664	0.607	E9QH65.pdb.gz
4	AFDB:Q9W3G0	0.834	0.765	5.824E-64	633	0.370	0.338	Q9W3G0.pdb.gz	Q9W3G0_DROME Phosphatidylinositol glycan anchor biosynthesis class T OS=Drosophila melanogaster OX=7227 GN=PIG-T PE=2 SV=1
5	AFDB:Q949U5	0.782	0.706	1.661E-55	644	0.336	0.301	Q949U5.pdb.gz	Q949U5_ARATH GPI transamidase component Gpi16 subunit family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07140 PE=1 SV=1
6	AFDB:P38875	0.730	0.695	7.497E-48	610	0.285	0.270	P38875.pdb.gz	GPI16_YEAST GPI transamidase component GPI16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI16 PE=1 SV=2
7	AFDB:O94380	0.711	0.752	3.928E-46	545	0.261	0.277	O94380.pdb.gz	GPI16_SCHPO GPI transamidase component PIG-T homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi16 PE=3 SV=1
8	AFDB:Q00776	0.164	0.194	1.451E-6	475	0.066	0.080	Q00776.pdb.gz	AP1M1_YEAST AP-1 complex subunit mu-1-I OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=APM1 PE=1 SV=2
9	AFDB:Q00651	0.164	0.104	3.852E-6	1039	0.099	0.055	Q00651.pdb.gz	ITA4_MOUSE Integrin alpha-4 OS=Mus musculus OX=10090 GN=Itga4 PE=1 SV=1
10	AFDB:Q8IEK4	0.156	0.198	8.688E-6	437	0.045	0.059	Q8IEK4.pdb.gz	Q8IEK4_PLAF7 AP-1 complex subunit mu-1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1311400 PE=3 SV=1
11	AFDB:P41543	0.177	0.202	1.341E-5	476	0.111	0.134	P41543.pdb.gz	OST1_YEAST Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OST1 PE=1 SV=1
12	PDB:1ddtA	0.156	0.170	1.217E-4	523	0.040	0.044	1ddtA.pdb.gz	Refined structure of dimeric diphtheria toxin at 2.0 A resolution.
13	PDB:2jkrM	0.180	0.238	2.898E-4	409	0.040	0.056	2jkrM.pdb.gz	A Structural Explanation for the Binding of Endocytic Dileucine Motifs by the Ap2 Complex.
14	PDB:4n20A	0.116	0.109	6.536E-4	639	0.043	0.039	4n20A.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
15	PDB:7uslA	0.148	0.108	6.536E-4	856	0.102	0.069	7uslA.pdb.gz	Structural basis for non-canonical integrin engagement by Bordetella adenylate cyclase toxin.
16	PDB:6cm9M	0.167	0.216	9.050E-4	415	0.031	0.043	6cm9M.pdb.gz	HIV-1 Nefs Are Cargo-Sensitive AP-1 Trimerization Switches in Tetherin Downregulation.
17	PDB:6k35A	0.151	0.139	1.397E-3	640	0.029	0.027	6k35A.pdb.gz	NAG-thiazoline is a potent inhibitor of the Vibrio campbellii GH20 beta-N-Acetylglucosaminidase.
18	PDB:4n2iA	0.111	0.101	1.643E-3	662	0.035	0.030	4n2iA.pdb.gz	Protein arginine deiminase 2 binds calcium in an ordered fashion: implications for inhibitor design.
19	PDB:7rwaM	0.185	0.261	2.275E-3	379	0.055	0.084	7rwaM.pdb.gz	Structural basis of an endocytic checkpoint that primes the AP2 clathrin adaptor for cargo internalization.
20	PDB:5a1wH	0.148	0.205	2.402E-3	380	0.048	0.074	5a1wH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BXQ2	0.0	1097	582	0.919	0.912	PIGT_MOUSE GPI transamidase component PIG-T OS=Mus musculus OX=10090 GN=Pigt PE=1 SV=2
2	Q969N2	0.0	1190	578	1.000	1.000	PIGT_HUMAN GPI transamidase component PIG-T OS=Homo sapiens OX=9606 GN=PIGT PE=1 SV=1
3	Q9W3G0	1.40e-127	390	633	0.375	0.343	Q9W3G0_DROME Phosphatidylinositol glycan anchor biosynthesis class T OS=Drosophila melanogaster OX=7227 GN=PIG-T PE=2 SV=1
4	Q949U5	2.39e-94	304	644	0.346	0.311	Q949U5_ARATH GPI transamidase component Gpi16 subunit family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07140 PE=1 SV=1
5	O94380	2.42e-58	206	545	0.261	0.277	GPI16_SCHPO GPI transamidase component PIG-T homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=gpi16 PE=3 SV=1
6	P38875	2.48e-35	142	610	0.144	0.136	GPI16_YEAST GPI transamidase component GPI16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GPI16 PE=1 SV=2
7	Q8BNA6	0.36	36.6	4555	0.035	0.004	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
8	F4I3J0	2.9	33.1	421	0.047	0.064	F4I3J0_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGD-2 PE=1 SV=1
9	Q92834	3.3	33.1	1020	0.057	0.032	RPGR_HUMAN X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens OX=9606 GN=RPGR PE=1 SV=2
10	Q9Y5F1	8.1	32.0	795	0.042	0.030	PCDBC_HUMAN Protocadherin beta-12 OS=Homo sapiens OX=9606 GN=PCDHB12 PE=1 SV=1
11	F1QA09	9.4	32.0	4546	0.052	0.007	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
12	X1WCY4	9.4	32.0	4578	0.052	0.007	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04113 Gpi16	1.4e-144	494.2	Gpi16 subunit, GPI transamidase component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000279036

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309430	0.999	GPI transamidase component PIG-S
2	9606.ENSP00000347206	0.999	Glycosylphosphatidylinositol anchor attachment 1 protein
3	9606.ENSP00000359848	0.999	GPI-anchor transamidase
4	9606.ENSP00000217446	0.998	Phosphatidylinositol glycan anchor biosynthesis class U protein
5	9606.ENSP00000346809	0.982	GPI inositol-deacylase
6	9606.ENSP00000367880	0.949	GPI ethanolamine phosphate transferase 3
7	9606.ENSP00000369820	0.907	Phosphatidylinositol N-acetylglucosaminyltransferase subunit A
8	9606.ENSP00000339328	0.901	Urokinase plasminogen activator surface receptor
9	9606.ENSP00000357069	0.891	GPI mannosyltransferase 1
10	9606.ENSP00000225609	0.865	N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase
11	9606.ENSP00000363260	0.854	GPI mannosyltransferase 2
12	9606.ENSP00000281382	0.843	Phosphatidylinositol-glycan biosynthesis class F protein
13	9606.ENSP00000164305	0.816	GPI mannosyltransferase 3
14	9606.ENSP00000356702	0.805	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
15	9606.ENSP00000350263	0.801	GPI ethanolamine phosphate transferase 1
16	9606.ENSP00000278243	0.800	Post-GPI attachment to proteins factor 2
17	9606.ENSP00000300658	0.794	Post-GPI attachment to proteins factor 3
18	9606.ENSP00000026218	0.763	Phosphatidylinositol N-acetylglucosaminyltransferase subunit Q
19	9606.ENSP00000420037	0.759	Phosphatidylinositol N-acetylglucosaminyltransferase subunit P
20	9606.ENSP00000376911	0.742	Legumain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.996	lipid metabolic process
GO:1901566	0.996	organonitrogen compound biosynthetic process
GO:0036211	0.996	protein modification process
GO:1901135	0.995	carbohydrate derivative metabolic process
GO:0034645	0.995	cellular macromolecule biosynthetic process
GO:0006506	0.991	GPI anchor biosynthetic process
GO:0016255	0.338	attachment of GPI anchor to protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0042765	0.999	GPI-anchor transamidase complex
GO:0031982	0.550	vesicle
GO:0031410	0.491	cytoplasmic vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]