StarFunc result for job id Q969P5

User Input

>input (355 residues)
MPFLGQDWRSPGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVA
AKKRKKDMLNSKTKTQYFHQEKWIYVHKGSTKERHGYCTLGEAFNRLDFSTAILDSRRFN
YVVRLLELIAKSQLTSLSGIAQKNFMNILEKVVLKVLEDQQNIRLIRELLQTLYTSLCTL
VQRVGKSVLVGNINMWVYRMETILHWQQQLNNIQITRPAFKGLTFTDLPLCLQLNIMQRL
SDGRDLVSLGQAAPDLHVLSEDRLLWKKLCQYHFSERQIRKRLILSDKGQLDWKKMYFKL
VRCYPRKEQYGDTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDFINLFKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9F3	0.762	0.762	1.763E-53	355	1.000	1.000	A0A024R9F3.pdb.gz
2	AFDB:F1R1Z0	0.852	0.850	7.153E-47	356	0.761	0.758	F1R1Z0.pdb.gz
3	AFDB:Q9D2Y6	0.784	0.780	6.819E-39	357	0.611	0.608	Q9D2Y6.pdb.gz	FBX25_MOUSE F-box only protein 25 OS=Mus musculus OX=10090 GN=Fbxo25 PE=1 SV=1
4	AFDB:Q8TCJ0	0.779	0.755	2.076E-37	367	0.623	0.602	Q8TCJ0.pdb.gz	FBX25_HUMAN F-box only protein 25 OS=Homo sapiens OX=9606 GN=FBXO25 PE=1 SV=3
5	AFDB:Q8RXD3	0.211	0.238	8.766E-2	310	0.107	0.123	Q8RXD3.pdb.gz	AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana OX=3702 GN=AIP2 PE=1 SV=1
6	AFDB:P32744	0.153	0.061	9.232E-2	1020	0.104	0.036	P32744.pdb.gz	CLAS2_CAEEL Protein CLASP-2 OS=Caenorhabditis elegans OX=6239 GN=cls-2 PE=1 SV=3
7	PDB:6gx9A	0.171	0.081	1.473E-1	912	0.090	0.035	6gx9A.pdb.gz	Differential role for phosphorylation in alternative polyadenylation function versus nuclear import of SR-like protein CPSF6.
8	PDB:5mpbP	0.154	0.130	1.812E-1	440	0.099	0.080	5mpbP.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
9	AFDB:A0A024R794	0.242	0.102	1.905E-1	923	0.096	0.037	A0A024R794.pdb.gz
10	PDB:4jhjA	0.183	0.268	2.603E-1	216	0.085	0.139	4jhjA.pdb.gz	Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.
11	PDB:5l3tA	0.132	0.154	2.742E-1	294	0.079	0.095	5l3tA.pdb.gz	The Sac3 TPR-like region in the Saccharomyces cerevisiae TREX-2 complex is more extensive but independent of the CID region.
12	PDB:4bsmA	0.146	0.071	2.887E-1	896	0.124	0.049	4bsmA.pdb.gz
13	AFDB:O74547	0.159	0.139	3.197E-1	422	0.149	0.126	O74547.pdb.gz	BIT61_SCHPO Target of rapamycin complex 2 subunit bit61 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bit61 PE=1 SV=1
14	AFDB:P39936	0.176	0.083	3.197E-1	914	0.104	0.040	P39936.pdb.gz	IF4F2_YEAST Eukaryotic initiation factor 4F subunit p130 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TIF4632 PE=1 SV=1
15	PDB:4cguA	0.187	0.429	3.551E-1	112	0.039	0.125	4cguA.pdb.gz	Structural Basis for Phosphorylation-Dependent Recruitment of Tel2 to Hsp90 by Pih1.
16	PDB:7q3dA	0.184	0.129	3.551E-1	545	0.056	0.037	7q3dA.pdb.gz
17	PDB:8a3tH	0.172	0.134	3.551E-1	505	0.090	0.063	8a3tH.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	AFDB:Q8VZ31	0.094	0.104	3.734E-1	310	0.082	0.094	Q8VZ31.pdb.gz	Q8VZ31_ARATH Tetratricopeptide repeat (TPR)-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=TPR4 PE=1 SV=1
19	PDB:6xt9D	0.106	0.101	7.330E-1	396	0.070	0.063	6xt9D.pdb.gz
20	PDB:3jckF	0.107	0.101	7.719E-1	388	0.096	0.088	3jckF.pdb.gz	Atomic structure of the 26S proteasome lid reveals the mechanism of deubiquitinase inhibition.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7ZTY2	0.0	565	356	0.761	0.758	Q7ZTY2_DANRE F-box only protein 32 OS=Danio rerio OX=7955 GN=zgc:56479 PE=2 SV=1
2	Q91Z62	0.0	701	350	0.952	0.966	FBX32_RAT F-box only protein 32 OS=Rattus norvegicus OX=10116 GN=Fbxo32 PE=2 SV=1
3	Q969P5	0.0	738	355	1.000	1.000	FBX32_HUMAN F-box only protein 32 OS=Homo sapiens OX=9606 GN=FBXO32 PE=1 SV=1
4	Q9CPU7	0.0	717	355	0.966	0.966	FBX32_MOUSE F-box only protein 32 OS=Mus musculus OX=10090 GN=Fbxo32 PE=2 SV=1
5	Q8TCJ0	1.84e-157	447	367	0.623	0.602	FBX25_HUMAN F-box only protein 25 OS=Homo sapiens OX=9606 GN=FBXO25 PE=1 SV=3
6	Q9D2Y6	1.97e-156	445	357	0.620	0.616	FBX25_MOUSE F-box only protein 25 OS=Mus musculus OX=10090 GN=Fbxo25 PE=1 SV=1
7	B7ZDC8	0.13	36.6	544	0.068	0.044	B7ZDC8_DANRE F-box and WD repeat domain-containing 7 OS=Danio rerio OX=7955 GN=fbxw7 PE=4 SV=1
8	F4KAN2	0.74	34.3	626	0.048	0.027	F4KAN2_ARATH Galactose oxidase/kelch repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=ZTL PE=1 SV=1
9	Q94BT6	0.75	34.3	609	0.048	0.028	ADO1_ARATH Adagio protein 1 OS=Arabidopsis thaliana OX=3702 GN=ADO1 PE=1 SV=2
10	A0A499FIY5	0.89	33.9	494	0.051	0.036	A0A499FIY5_HUMAN F-box and WD repeat domain containing 8 OS=Homo sapiens OX=9606 GN=FBXW8 PE=1 SV=1
11	Q8N3Y1	1.3	33.5	598	0.051	0.030	FBXW8_HUMAN F-box/WD repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=FBXW8 PE=1 SV=2
12	Q8VBV4	1.3	33.5	710	0.068	0.034	FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus OX=10090 GN=Fbxw7 PE=1 SV=2
13	Q969H0	1.5	33.1	707	0.065	0.033	FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=FBXW7 PE=1 SV=1
14	O75426	7.3	31.2	580	0.045	0.028	FBX24_HUMAN F-box only protein 24 OS=Homo sapiens OX=9606 GN=FBXO24 PE=1 SV=2
15	Q04511	7.4	31.2	668	0.118	0.063	UFO1_YEAST Ubiquitin ligase complex F-box protein UFO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UFO1 PE=1 SV=1
16	P38114	9.8	30.8	1094	0.070	0.023	TBS1_YEAST Uncharacterized transcriptional regulatory protein TBS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TBS1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06881 Elongin_A	0.41	22.6	RNA polymerase II transcription factor SIII (Elongin) subunit A
2	PF12937 F-box-like	1e+02	14.2	F-box-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000428205

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000231487	0.996	S-phase kinase-associated protein 1
2	9606.ENSP00000250003	0.981	Myoblast determination protein 1
3	9606.ENSP00000385824	0.981	Forkhead box protein O3
4	9606.ENSP00000368880	0.977	Forkhead box protein O1
5	9606.ENSP00000326804	0.960	Cullin-1
6	9606.ENSP00000363377	0.959	Forkhead box protein O4
7	9606.ENSP00000363390	0.922	E3 ubiquitin-protein ligase TRIM63
8	9606.ENSP00000431800	0.890	Eukaryotic translation initiation factor 3 subunit F
9	9606.ENSP00000072644	0.880	Protein YIPF1
10	9606.ENSP00000241651	0.863	Myogenin
11	9606.ENSP00000260950	0.862	Growth/differentiation factor 8
12	9606.ENSP00000372274	0.851	F-box only protein 25
13	9606.ENSP00000328187	0.748	F-box only protein 21
14	9606.ENSP00000302665	0.710	Insulin-like growth factor I
15	9606.ENSP00000386041	0.710	Myosin-6
16	9606.ENSP00000296098	0.709	Tripartite motif containing 54
17	9606.ENSP00000451828	0.708	RAC-alpha serine/threonine-protein kinase
18	9606.ENSP00000363787	0.707	E3 ubiquitin-protein ligase RING1
19	9606.ENSP00000225577	0.692	Ribosomal protein S6 kinase beta-1
20	9606.ENSP00000216225	0.683	E3 ubiquitin-protein ligase RBX1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.449	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0009987	0.992	cellular process
GO:0019538	0.986	protein metabolic process
GO:0050789	0.945	regulation of biological process
GO:0050794	0.902	regulation of cellular process
GO:0050896	0.900	response to stimulus
GO:0090257	0.800	regulation of muscle system process
GO:0048518	0.772	positive regulation of biological process
GO:0036211	0.719	protein modification process
GO:0044237	0.708	cellular metabolic process
GO:0070647	0.685	protein modification by small protein conjugation or removal
GO:0032446	0.682	protein modification by small protein conjugation
GO:0032501	0.671	multicellular organismal process
GO:0048583	0.651	regulation of response to stimulus
GO:0048519	0.538	negative regulation of biological process
GO:0051716	0.502	cellular response to stimulus
GO:0048522	0.493	positive regulation of cellular process
GO:0042221	0.404	response to chemical
GO:0016567	0.392	protein ubiquitination
GO:0009056	0.381	catabolic process
GO:0070887	0.309	cellular response to chemical stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.985	cytosol
GO:0032991	0.890	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]