StarFunc result for job id Q969Q1

User Input

>input (353 residues)
MDYKSSLIQDGNPMENLEKQLICPICLEMFTKPVVILPCQHNLCRKCANDIFQAANPYWT
SRGSSVSMSGGRFRCPTCRHEVIMDRHGVYGLQRNLLVENIIDIYKQECSSRPLQKGSHP
MCKEHEDEKINIYCLTCEVPTCSMCKVFGIHKACEVAPLQSVFQGQKTELNNCISMLVAG
NDRVQTIITQLEDSRRVTKENSHQVKEELSQKFDTLYAILDEKKSELLQRITQEQEKKLS
FIEALIQQYQEQLDKSTKLVETAIQSLDEPGGATFLLTAKQLIKSIVEASKGCQLGKTEQ
GFENMDFFTLDLEHIADALRAIDFGTDEEEEEFIEEEDQEEEESTEGKEEGHQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969Q1	1.000	1.000	4.209E-59	353	1.000	1.000	Q969Q1.pdb.gz	TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens OX=9606 GN=TRIM63 PE=1 SV=1
2	AFDB:Q9ERP3	0.720	0.698	4.071E-41	366	0.592	0.571	Q9ERP3.pdb.gz	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1
3	AFDB:Q9BYV6	0.787	0.525	1.545E-40	548	0.589	0.380	Q9BYV6.pdb.gz	TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens OX=9606 GN=TRIM55 PE=1 SV=2
4	AFDB:G3X8Y1	0.762	0.513	4.338E-39	545	0.578	0.374	G3X8Y1.pdb.gz	G3X8Y1_MOUSE Tripartite motif-containing 55 OS=Mus musculus OX=10090 GN=Trim55 PE=1 SV=1
5	AFDB:Q9UJV3	0.518	0.261	1.908E-21	735	0.266	0.128	Q9UJV3.pdb.gz	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
6	AFDB:O70583	0.544	0.288	6.816E-21	680	0.280	0.146	O70583.pdb.gz	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
7	AFDB:Q80WG7	0.310	0.164	1.501E-19	729	0.286	0.139	Q80WG7.pdb.gz	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
8	AFDB:Q8C7M3	0.465	0.227	1.598E-18	817	0.255	0.110	Q8C7M3.pdb.gz	TRIM9_MOUSE E3 ubiquitin-protein ligase TRIM9 OS=Mus musculus OX=10090 GN=Trim9 PE=1 SV=2
9	AFDB:Q91ZY8	0.416	0.238	3.113E-18	710	0.255	0.127	Q91ZY8.pdb.gz	TRIM9_RAT E3 ubiquitin-protein ligase TRIM9 OS=Rattus norvegicus OX=10116 GN=Trim9 PE=1 SV=1
10	AFDB:A0A0G2JXN2	0.311	0.176	5.056E-18	759	0.289	0.134	A0A0G2JXN2.pdb.gz	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
11	PDB:7z36B	0.428	0.352	1.627E-9	446	0.147	0.117	7z36B.pdb.gz	Structure and functional mapping of the KRAB-KAP1 repressor complex.
12	PDB:4tn3B	0.376	0.369	1.851E-4	362	0.113	0.110	4tn3B.pdb.gz	Structural studies of postentry restriction factors reveal antiparallel dimers that enable avid binding to the HIV-1 capsid lattice.
13	PDB:4r8pL	0.178	0.239	5.189E-4	254	0.079	0.110	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
14	PDB:7od1A	0.147	0.123	1.457E-2	430	0.068	0.056	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
15	PDB:7jzvA	0.205	0.276	1.973E-2	253	0.074	0.103	7jzvA.pdb.gz	BRCA1/BARD1 site-specific ubiquitylation of nucleosomal H2A is directed by BARD1.
16	PDB:7oniH	0.134	0.125	2.671E-2	380	0.127	0.118	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
17	PDB:5dkaA	0.098	0.341	2.838E-2	96	0.054	0.198	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
18	PDB:7qcdC	0.161	0.205	3.617E-2	267	0.045	0.060	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
19	PDB:5gm6a	0.165	0.429	1.145E-1	123	0.057	0.163	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
20	PDB:3m62A	0.185	0.073	1.373E-1	955	0.048	0.018	3m62A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q38HM4	0.0	624	350	0.847	0.854	TRI63_MOUSE E3 ubiquitin-protein ligase TRIM63 OS=Mus musculus OX=10090 GN=Trim63 PE=1 SV=1
2	Q91Z63	0.0	633	351	0.856	0.860	TRI63_RAT E3 ubiquitin-protein ligase TRIM63 OS=Rattus norvegicus OX=10116 GN=Trim63 PE=2 SV=1
3	Q969Q1	0.0	728	353	1.000	1.000	TRI63_HUMAN E3 ubiquitin-protein ligase TRIM63 OS=Homo sapiens OX=9606 GN=TRIM63 PE=1 SV=1
4	Q9BYV2	2.48e-151	432	358	0.598	0.589	TRI54_HUMAN Tripartite motif-containing protein 54 OS=Homo sapiens OX=9606 GN=TRIM54 PE=1 SV=3
5	Q9ERP3	2.59e-150	429	366	0.589	0.568	TRI54_MOUSE Tripartite motif-containing protein 54 OS=Mus musculus OX=10090 GN=Trim54 PE=1 SV=1
6	Q9BYV6	3.27e-144	421	548	0.569	0.367	TRI55_HUMAN Tripartite motif-containing protein 55 OS=Homo sapiens OX=9606 GN=TRIM55 PE=1 SV=2
7	G3X8Y1	2.39e-142	416	545	0.564	0.365	G3X8Y1_MOUSE Tripartite motif-containing 55 OS=Mus musculus OX=10090 GN=Trim55 PE=1 SV=1
8	Q8C6Y1	2.01e-102	301	197	0.397	0.711	Q8C6Y1_MOUSE Tripartite motif-containing protein 55 (Fragment) OS=Mus musculus OX=10090 GN=Trim55 PE=2 SV=1
9	A0A0G2JXN2	5.87e-38	146	759	0.317	0.148	TRI46_RAT Tripartite motif-containing protein 46 OS=Rattus norvegicus OX=10116 GN=Trim46 PE=1 SV=2
10	Q7TNM2	1.27e-37	145	759	0.314	0.146	TRI46_MOUSE Tripartite motif-containing protein 46 OS=Mus musculus OX=10090 GN=Trim46 PE=1 SV=1
11	C9J453	6.02e-37	140	483	0.292	0.213	C9J453_HUMAN RING-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
12	O15344	5.52e-36	140	667	0.297	0.157	TRI18_HUMAN E3 ubiquitin-protein ligase Midline-1 OS=Homo sapiens OX=9606 GN=MID1 PE=1 SV=1
13	Q80WG7	3.92e-35	138	729	0.292	0.141	TRI36_MOUSE E3 ubiquitin-protein ligase Trim36 OS=Mus musculus OX=10090 GN=Trim36 PE=1 SV=2
14	Q9NQ86	5.21e-35	137	728	0.292	0.141	TRI36_HUMAN E3 ubiquitin-protein ligase TRIM36 OS=Homo sapiens OX=9606 GN=TRIM36 PE=1 SV=2
15	O70583	3.53e-25	108	680	0.269	0.140	TRI18_MOUSE E3 ubiquitin-protein ligase Midline-1 OS=Mus musculus OX=10090 GN=Mid1 PE=1 SV=2
16	Q9UJV3	3.76e-24	105	735	0.272	0.131	TRIM1_HUMAN Probable E3 ubiquitin-protein ligase MID2 OS=Homo sapiens OX=9606 GN=MID2 PE=1 SV=3
17	Q8IWR1	1.79e-20	94.0	403	0.190	0.166	TRI59_HUMAN Tripartite motif-containing protein 59 OS=Homo sapiens OX=9606 GN=TRIM59 PE=1 SV=1
18	Q922Y2	2.42e-20	93.6	403	0.190	0.166	TRI59_MOUSE Tripartite motif-containing protein 59 OS=Mus musculus OX=10090 GN=Trim59 PE=1 SV=2
19	O60858	1.26e-19	91.3	407	0.221	0.192	TRI13_HUMAN E3 ubiquitin-protein ligase TRIM13 OS=Homo sapiens OX=9606 GN=TRIM13 PE=1 SV=2
20	Q9CYB0	3.56e-19	90.1	407	0.207	0.179	TRI13_MOUSE E3 ubiquitin-protein ligase TRIM13 OS=Mus musculus OX=10090 GN=Trim13 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05549 Allexi_40kDa	4.1e+02	11.9	Allexivirus 40kDa protein
2	PF08112 ATP-synt_E_2	39	15.9	ATP synthase epsilon subunit
3	PF07889 DUF1664	41	15.6	Protein of unknown function (DUF1664)
4	PF05335 DUF745	42	15.3	Protein of unknown function (DUF745)
5	PF04799 Fzo_mitofusin	1.2e+02	13.5	fzo-like conserved region
6	PF17192 MukF_M	9.6e+02	11.0	MukF middle domain
7	PF05597 Phasin	3e+02	12.9	Poly(hydroxyalcanoate) granule associated protein (phasin)
8	PF06093 Spt4	2.4e+02	13.2	Spt4/RpoE2 zinc finger
9	PF14266 YceG_bac	23	15.4	Putative component of 'biosynthetic module'
10	PF00643 zf-B_box	0.0061	28.0	B-box zinc finger
11	PF00097 zf-C3HC4	0.00022	32.4	Zinc finger, C3HC4 type (RING finger)
12	PF13923 zf-C3HC4_2	0.00015	32.8	Zinc finger, C3HC4 type (RING finger)
13	PF13920 zf-C3HC4_3	0.0073	27.4	Zinc finger, C3HC4 type (RING finger)
14	PF15227 zf-C3HC4_4	0.086	24.3	zinc finger of C3HC4-type, RING
15	PF13639 zf-RING_2	0.011	27.4	Ring finger domain
16	PF14634 zf-RING_5	0.00071	30.8	zinc-RING finger domain
17	PF14835 zf-RING_6	0.38	22.0	zf-RING of BARD1-type protein
18	PF13445 zf-RING_UBOX	1.6e-07	42.5	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000363390

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467141	0.998	Titin
2	9606.ENSP00000385824	0.969	Forkhead box protein O3
3	9606.ENSP00000368880	0.967	Forkhead box protein O1
4	9606.ENSP00000312624	0.937	Telethonin
5	9606.ENSP00000231509	0.936	Glucocorticoid receptor
6	9606.ENSP00000262160	0.936	Mothers against decapentaplegic homolog 2
7	9606.ENSP00000332973	0.931	Mothers against decapentaplegic homolog 3
8	9606.ENSP00000428205	0.922	F-box only protein 32
9	9606.ENSP00000341551	0.914	Mothers against decapentaplegic homolog 4
10	9606.ENSP00000072644	0.870	Protein YIPF1
11	9606.ENSP00000411250	0.869	Next to BRCA1 gene 1 protein
12	9606.ENSP00000374455	0.850	Sequestosome-1
13	9606.ENSP00000349722	0.840	Ubiquitin conjugating enzyme E2 D3
14	9606.ENSP00000260950	0.837	Growth/differentiation factor 8
15	9606.ENSP00000363787	0.790	E3 ubiquitin-protein ligase RING1
16	9606.ENSP00000221476	0.779	Creatine kinase M-type
17	9606.ENSP00000386041	0.777	Myosin-6
18	9606.ENSP00000363019	0.740	Ubiquitin-conjugating enzyme E2 D1
19	9606.ENSP00000484342	0.724	Nebulin
20	9606.ENSP00000263966	0.723	Ubiquitin carboxyl-terminal hydrolase 13

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0008092	0.998	cytoskeletal protein binding
GO:0061659	0.815	ubiquitin-like protein ligase activity
GO:0061630	0.782	ubiquitin protein ligase activity
GO:0031432	0.382	titin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.989	regulation of biological process
GO:0009987	0.982	cellular process
GO:0050896	0.978	response to stimulus
GO:0048583	0.972	regulation of response to stimulus
GO:0090257	0.972	regulation of muscle system process
GO:0043502	0.955	regulation of muscle adaptation
GO:0031960	0.947	response to corticosteroid
GO:0051384	0.943	response to glucocorticoid
GO:0071704	0.928	organic substance metabolic process
GO:0051716	0.875	cellular response to stimulus
GO:0043170	0.860	macromolecule metabolic process
GO:0044238	0.853	primary metabolic process
GO:0032501	0.847	multicellular organismal process
GO:0050794	0.846	regulation of cellular process
GO:0006807	0.820	nitrogen compound metabolic process
GO:0070887	0.814	cellular response to chemical stimulus
GO:0019222	0.786	regulation of metabolic process
GO:0044237	0.783	cellular metabolic process
GO:0019538	0.732	protein metabolic process
GO:1901654	0.719	response to ketone
GO:0003008	0.717	system process
GO:0060255	0.709	regulation of macromolecule metabolic process
GO:0009056	0.689	catabolic process
GO:0048519	0.688	negative regulation of biological process
GO:0009057	0.667	macromolecule catabolic process
GO:0071548	0.656	response to dexamethasone
GO:0071310	0.564	cellular response to organic substance
GO:0043632	0.484	modification-dependent macromolecule catabolic process
GO:0010468	0.466	regulation of gene expression
GO:0070647	0.464	protein modification by small protein conjugation or removal
GO:0080090	0.459	regulation of primary metabolic process
GO:0016567	0.454	protein ubiquitination
GO:0031323	0.453	regulation of cellular metabolic process
GO:0071383	0.448	cellular response to steroid hormone stimulus
GO:0071385	0.442	cellular response to glucocorticoid stimulus
GO:0071549	0.434	cellular response to dexamethasone stimulus
GO:0051171	0.433	regulation of nitrogen compound metabolic process
GO:0048518	0.419	positive regulation of biological process
GO:0048523	0.387	negative regulation of cellular process
GO:0003012	0.378	muscle system process
GO:0006508	0.340	proteolysis
GO:0030163	0.326	protein catabolic process
GO:0032502	0.312	developmental process
GO:0048522	0.305	positive regulation of cellular process
GO:0019941	0.304	modification-dependent protein catabolic process
GO:0051252	0.300	regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	0.957	intracellular organelle
GO:0032991	0.889	protein-containing complex
GO:0043231	0.828	intracellular membrane-bounded organelle
GO:0005829	0.827	cytosol
GO:0005634	0.746	nucleus
GO:0043232	0.743	intracellular non-membrane-bounded organelle
GO:0070013	0.384	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]