StarFunc result for job id Q969Q6

User Input

>input (453 residues)
MDWKEVLRRRLATPNTCPNKKKSEQELKDEEMDLFTKYYSEWKGGRKNTNEFYKTIPRFY
YRLPAEDEVLLQKLREESRAVFLQRKSRELLDNEELQNLWFLLDKHQTPPMIGEEAMINY
ENFLKVGEKAGAKCKQFFTAKVFAKLLHTDSYGRISIMQFFNYVMRKVWLHQTRIGLSLY
DVAGQGYLRESDLENYILELIPTLPQLDGLEKSFYSFYVCTAVRKFFFFLDPLRTGKIKI
QDILACSFLDDLLELRDEELSKESQETNWFSAPSALRVYGQYLNLDKDHNGMLSKEELSR
YGTATMTNVFLDRVFQECLTYDGEMDYKTYLDFVLALENRKEPAALQYIFKLLDIENKGY
LNVFSLNYFFRAIQELMKIHGQDPVSFQDVKDEIFDMVKPKDPLKISLQDLINSNQGDTV
TTILIDLNGFWTYENREALVANDSENSADLDDT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969Q6	1.000	1.000	2.131E-66	453	1.000	1.000	Q969Q6.pdb.gz	P2R3C_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Homo sapiens OX=9606 GN=PPP2R3C PE=1 SV=1
2	AFDB:Q9FEE2	0.816	0.773	1.820E-35	480	0.366	0.346	Q9FEE2.pdb.gz	TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 OS=Arabidopsis thaliana OX=3702 GN=TON2 PE=1 SV=1
3	AFDB:Q580J5	0.657	0.611	6.673E-19	492	0.258	0.238	Q580J5.pdb.gz	Q580J5_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.810 PE=4 SV=1
4	AFDB:Q8VZQ4	0.556	0.475	1.027E-17	536	0.205	0.174	Q8VZQ4.pdb.gz	2AB2C_ARATH Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma OS=Arabidopsis thaliana OX=3702 GN=B''GAMMA PE=1 SV=1
5	AFDB:E9QG28	0.549	0.222	1.858E-17	1192	0.201	0.076	E9QG28.pdb.gz	E9QG28_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=2
6	AFDB:Q9Z176	0.537	0.498	4.219E-17	491	0.188	0.173	Q9Z176.pdb.gz	P2R3D_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta OS=Mus musculus OX=10090 GN=Ppp2r3d PE=2 SV=1
7	AFDB:Q9XGR4	0.546	0.465	1.259E-16	538	0.214	0.180	Q9XGR4.pdb.gz	2AB2A_ARATH Serine/threonine protein phosphatase 2A regulatory subunit B''alpha OS=Arabidopsis thaliana OX=3702 GN=B''ALPHA PE=1 SV=1
8	AFDB:Q06190	0.548	0.228	1.813E-16	1150	0.194	0.077	Q06190.pdb.gz	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1
9	AFDB:Q9Y5P8	0.546	0.436	1.898E-16	575	0.183	0.144	Q9Y5P8.pdb.gz	P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2
10	AFDB:A0A803JG39	0.556	0.236	2.079E-16	1129	0.190	0.076	A0A803JG39.pdb.gz	A0A803JG39_XENTR Protein phosphatase 2 regulatory subunit B''alpha OS=Xenopus tropicalis OX=8364 GN=ppp2r3a PE=4 SV=1
11	PDB:6tz8B	0.241	0.519	6.725E-4	174	0.082	0.213	6tz8B.pdb.gz	Harnessing calcineurin-FK506-FKBP12 crystal structures from invasive fungal pathogens to develop antifungal agents.
12	PDB:2becA	0.254	0.554	1.013E-3	181	0.071	0.177	2becA.pdb.gz	Crystal structure of CHP2 complexed with NHE1-cytosolic region and an implication for pH regulation
13	PDB:7u0tA	0.235	0.475	1.527E-3	190	0.079	0.189	7u0tA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
14	PDB:4il1A	0.228	0.200	1.751E-3	529	0.062	0.053	4il1A.pdb.gz	Structural basis of calcineurin activation by calmodulin.
15	PDB:1v1fA	0.249	0.513	1.833E-3	188	0.057	0.138	1v1fA.pdb.gz	The Structure of the Arabidopsis Thaliana SOS3: Molecular Mechanism of Sensing Calcium for Salt Stress Response
16	PDB:3wfnB	0.155	0.344	2.302E-3	169	0.060	0.160	3wfnB.pdb.gz
17	PDB:5d43A	0.146	0.355	2.521E-3	150	0.073	0.220	5d43A.pdb.gz	Crystal Structure of Wild-Type Centrin 1 from Mus musculus Occupied by Ca2.
18	PDB:5aanA	0.263	0.559	3.469E-3	183	0.075	0.186	5aanA.pdb.gz	Interference of the complex between NCS-1 and Ric8a with phenothiazines regulates synaptic function and is an approach for fragile X syndrome.
19	PDB:5a2hA	0.135	0.348	3.977E-3	147	0.053	0.163	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
20	PDB:2ggzA	0.263	0.632	4.356E-3	165	0.071	0.194	2ggzA.pdb.gz	The Crystal Structure of GCAP3 Suggests Molecular Mechanism of GCAP-linked Cone Dystrophies.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969Q6	0.0	935	453	1.000	1.000	P2R3C_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Homo sapiens OX=9606 GN=PPP2R3C PE=1 SV=1
2	Q9JK24	0.0	917	453	0.982	0.982	P2R3C_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma OS=Mus musculus OX=10090 GN=Ppp2r3c PE=1 SV=2
3	A0A0C4DGK2	3.96e-120	349	167	0.369	1.000	A0A0C4DGK2_HUMAN Protein phosphatase 2 regulatory subunit B''gamma (Fragment) OS=Homo sapiens OX=9606 GN=PPP2R3C PE=1 SV=1
4	Q86US5	1.48e-119	348	190	0.369	0.879	Q86US5_HUMAN Chromosome 14 open reading frame transcript variant 2 OS=Homo sapiens OX=9606 GN=PPP2R3C PE=1 SV=1
5	Q9FEE2	1.35e-93	293	480	0.375	0.354	TON2_ARATH Probable serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit TON2 OS=Arabidopsis thaliana OX=3702 GN=TON2 PE=1 SV=1
6	Q580J5	2.54e-38	147	492	0.243	0.224	Q580J5_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb03.26J7.810 PE=4 SV=1
7	Q9XGR4	1.48e-30	125	538	0.194	0.164	2AB2A_ARATH Serine/threonine protein phosphatase 2A regulatory subunit B''alpha OS=Arabidopsis thaliana OX=3702 GN=B''ALPHA PE=1 SV=1
8	B0S5Q0	2.48e-29	122	520	0.190	0.165	B0S5Q0_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=1
9	Q8VZQ4	9.95e-28	117	536	0.159	0.134	2AB2C_ARATH Probable serine/threonine protein phosphatase 2A regulatory subunit B''gamma OS=Arabidopsis thaliana OX=3702 GN=B''GAMMA PE=1 SV=1
10	E9QG28	1.48e-27	118	1192	0.159	0.060	E9QG28_DANRE Protein phosphatase 2, regulatory subunit B'', alpha OS=Danio rerio OX=7955 GN=ppp2r3a PE=4 SV=2
11	Q06190	4.04e-27	117	1150	0.166	0.065	P2R3A_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit alpha OS=Homo sapiens OX=9606 GN=PPP2R3A PE=1 SV=1
12	Q9Y5P8	1.49e-26	114	575	0.152	0.120	P2R3B_HUMAN Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit beta OS=Homo sapiens OX=9606 GN=PPP2R3B PE=1 SV=2
13	Q9Z176	6.56e-25	109	491	0.166	0.153	P2R3D_MOUSE Serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit delta OS=Mus musculus OX=10090 GN=Ppp2r3d PE=2 SV=1
14	A0A803JG39	7.17e-24	107	1129	0.163	0.066	A0A803JG39_XENTR Protein phosphatase 2 regulatory subunit B''alpha OS=Xenopus tropicalis OX=8364 GN=ppp2r3a PE=4 SV=1
15	Q17744	1.13e-13	75.5	557	0.130	0.106	Q17744_CAEEL EF-hand domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F43B10.1 PE=1 SV=4
16	Q38DH1	7.40e-07	53.9	681	0.117	0.078	Q38DH1_TRYB2 EF-hand domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3350 PE=4 SV=1
17	O02217	3.59e-06	51.2	404	0.086	0.097	P2R31_CAEEL Serine/threonine-protein phosphatase 2A regulatory subunit rsa-1 OS=Caenorhabditis elegans OX=6239 GN=rsa-1 PE=1 SV=2
18	P61022	0.011	39.3	195	0.046	0.108	CHP1_MOUSE Calcineurin B homologous protein 1 OS=Mus musculus OX=10090 GN=Chp1 PE=1 SV=2
19	P61023	0.011	39.3	195	0.046	0.108	CHP1_RAT Calcineurin B homologous protein 1 OS=Rattus norvegicus OX=10116 GN=Chp1 PE=1 SV=2
20	Q99653	0.011	39.3	195	0.053	0.123	CHP1_HUMAN Calcineurin B homologous protein 1 OS=Homo sapiens OX=9606 GN=CHP1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01886 DUF61	1.5e+02	13.9	Protein of unknown function DUF61
2	PF00036 EF-hand_1	0.1	23.3	EF hand
3	PF17958 EF-hand_13	0.031	25.4	EF-hand domain
4	PF13202 EF-hand_5	62	14.5	EF hand
5	PF13405 EF-hand_6	0.0092	26.8	EF-hand domain
6	PF13499 EF-hand_7	0.00035	32.3	EF-hand domain pair
7	PF13833 EF-hand_8	2.5e+02	12.9	EF-hand domain pair

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000261475

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221138	0.926	Serine/threonine-protein phosphatase 2A catalytic subunit beta isoform
2	9606.ENSP00000355812	0.873	FGFR1 oncogene partner
3	9606.ENSP00000261461	0.864	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit alpha isoform
4	9606.ENSP00000412324	0.863	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit gamma isoform
5	9606.ENSP00000297431	0.851	Origin recognition complex subunit 5
6	9606.ENSP00000337641	0.846	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit epsilon isoform
7	9606.ENSP00000417963	0.824	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform
8	9606.ENSP00000164133	0.823	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit beta isoform
9	9606.ENSP00000295050	0.823	SprT-like domain-containing protein Spartan
10	9606.ENSP00000378699	0.818	Cyclin-dependent kinase 1
11	9606.ENSP00000350071	0.804	Striatin-3
12	9606.ENSP00000403701	0.800	Beta-arrestin-2
13	9606.ENSP00000409581	0.800	Beta-arrestin-1
14	9606.ENSP00000311344	0.792	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform
15	9606.ENSP00000324804	0.788	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform
16	9606.ENSP00000377036	0.788	Serine/threonine-protein phosphatase 2A activator
17	9606.ENSP00000418447	0.787	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
18	9606.ENSP00000430684	0.761	Inhibitor of nuclear factor kappa-B kinase subunit beta
19	9606.ENSP00000399970	0.748	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B delta isoform
20	9606.ENSP00000325074	0.713	Serine/threonine-protein phosphatase 2A 55 kDa regulatory subunit B alpha isoform

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0098772	0.346	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0048518	0.982	positive regulation of biological process
GO:0065009	0.977	regulation of molecular function
GO:0031323	0.971	regulation of cellular metabolic process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0060255	0.965	regulation of macromolecule metabolic process
GO:0048522	0.938	positive regulation of cellular process
GO:0002682	0.907	regulation of immune system process
GO:0032501	0.906	multicellular organismal process
GO:0009987	0.903	cellular process
GO:0032502	0.902	developmental process
GO:0048731	0.886	system development
GO:0050865	0.873	regulation of cell activation
GO:0002376	0.866	immune system process
GO:0051249	0.851	regulation of lymphocyte activation
GO:0042592	0.847	homeostatic process
GO:0002684	0.846	positive regulation of immune system process
GO:0002260	0.819	lymphocyte homeostasis
GO:0009893	0.808	positive regulation of metabolic process
GO:0050790	0.806	regulation of catalytic activity
GO:0051246	0.805	regulation of protein metabolic process
GO:0060284	0.801	regulation of cell development
GO:0050864	0.800	regulation of B cell activation
GO:0051174	0.792	regulation of phosphorus metabolic process
GO:1903706	0.777	regulation of hemopoiesis
GO:0051338	0.771	regulation of transferase activity
GO:1902105	0.770	regulation of leukocyte differentiation
GO:0048583	0.753	regulation of response to stimulus
GO:0019220	0.744	regulation of phosphate metabolic process
GO:0044093	0.731	positive regulation of molecular function
GO:0031399	0.731	regulation of protein modification process
GO:0045619	0.718	regulation of lymphocyte differentiation
GO:0010604	0.702	positive regulation of macromolecule metabolic process
GO:0042325	0.684	regulation of phosphorylation
GO:0043549	0.667	regulation of kinase activity
GO:0043085	0.662	positive regulation of catalytic activity
GO:0001932	0.629	regulation of protein phosphorylation
GO:0051173	0.622	positive regulation of nitrogen compound metabolic process
GO:0048513	0.618	animal organ development
GO:0031325	0.577	positive regulation of cellular metabolic process
GO:0002520	0.509	immune system development
GO:0031401	0.497	positive regulation of protein modification process
GO:0051251	0.487	positive regulation of lymphocyte activation
GO:0033674	0.487	positive regulation of kinase activity
GO:0045860	0.481	positive regulation of protein kinase activity
GO:0051094	0.435	positive regulation of developmental process
GO:0048534	0.412	hematopoietic or lymphoid organ development
GO:0032147	0.412	activation of protein kinase activity
GO:0032101	0.408	regulation of response to external stimulus
GO:0045597	0.407	positive regulation of cell differentiation
GO:0048536	0.399	spleen development
GO:0080134	0.378	regulation of response to stress
GO:0042391	0.370	regulation of membrane potential
GO:0002831	0.359	regulation of response to biotic stimulus
GO:0050776	0.358	regulation of immune response
GO:0031347	0.356	regulation of defense response
GO:0043029	0.336	T cell homeostasis
GO:0050871	0.333	positive regulation of B cell activation
GO:1903708	0.333	positive regulation of hemopoiesis
GO:0071704	0.327	organic substance metabolic process
GO:0003254	0.317	regulation of membrane depolarization
GO:0045621	0.310	positive regulation of lymphocyte differentiation
GO:0048519	0.307	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0005654	0.998	nucleoplasm
GO:0005856	0.997	cytoskeleton
GO:0012505	0.984	endomembrane system
GO:0015630	0.984	microtubule cytoskeleton
GO:0005794	0.912	Golgi apparatus
GO:0032991	0.910	protein-containing complex
GO:0005815	0.877	microtubule organizing center
GO:0005813	0.868	centrosome
GO:0016020	0.495	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]