StarFunc result for job id Q969R5

User Input

>input (705 residues)
MEKPRSIEETPSSEPMEEEEDDDLELFGGYDSFRSYNSSVGSESSSYLEESSEAENEDRE
AGELPTSPLHLLSPGTPRSLDGSGSEPAVCEMCGIVGTREAFFSKTKRFCSVSCSRSYSS
NSKKASILARLQGKPPTKKAKVLHKAAWSAKIGAFLHSQGTGQLADGTPTGQDALVLGFD
WGKFLKDHSYKAAPVSCFKHVPLYDQWEDVMKGMKVEVLNSDAVLPSRVYWIASVIQTAG
YRVLLRYEGFENDASHDFWCNLGTVDVHPIGWCAINSKILVPPRTIHAKFTDWKGYLMKR
LVGSRTLPVDFHIKMVESMKYPFRQGMRLEVVDKSQVSRTRMAVVDTVIGGRLRLLYEDG
DSDDDFWCHMWSPLIHPVGWSRRVGHGIKMSERRSDMAHHPTFRKIYCDAVPYLFKKVRA
VYTEGGWFEEGMKLEAIDPLNLGNICVATVCKVLLDGYLMICVDGGPSTDGLDWFCYHAS
SHAIFPATFCQKNDIELTPPKGYEAQTFNWENYLEKTKSKAAPSRLFNMDCPNHGFKVGM
KLEAVDLMEPRLICVATVKRVVHRLLSIHFDGWDSEYDQWVDCESPDIYPVGWCELTGYQ
LQPPVAAEPATPLKAKEATKKKKKQFGKKRKRIPPTKTRPLRQGSKKPLLEDDPQGARKI
SSEPVPGEIIAVRVKEEHLDVASPDKASSPELPVSVENIKQETDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969R5	1.000	1.000	0.000	705	1.000	1.000	Q969R5.pdb.gz	LMBL2_HUMAN Lethal(3)malignant brain tumor-like protein 2 OS=Homo sapiens OX=9606 GN=L3MBTL2 PE=1 SV=1
2	AFDB:Q6P5G3	0.607	0.677	1.563E-76	631	0.491	0.548	Q6P5G3.pdb.gz	MBTD1_MOUSE MBT domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mbtd1 PE=1 SV=1
3	AFDB:Q9VK33	0.583	0.344	2.369E-61	1220	0.380	0.220	Q9VK33.pdb.gz	SMBT_DROME Polycomb protein Sfmbt OS=Drosophila melanogaster OX=7227 GN=Sfmbt PE=1 SV=2
4	AFDB:A0A024R338	0.382	0.315	1.780E-37	866	0.226	0.184	A0A024R338.pdb.gz
5	AFDB:B2D6M2	0.517	0.591	8.059E-37	612	0.190	0.219	B2D6M2.pdb.gz	LIN61_CAEEL Protein lin-61 OS=Caenorhabditis elegans OX=6239 GN=lin-61 PE=1 SV=1
6	AFDB:Q9Y468	0.329	0.283	2.329E-30	840	0.226	0.189	Q9Y468.pdb.gz	LMBL1_HUMAN Lethal(3)malignant brain tumor-like protein 1 OS=Homo sapiens OX=9606 GN=L3MBTL1 PE=1 SV=4
7	AFDB:Q8NA19	0.308	0.343	3.051E-29	623	0.179	0.202	Q8NA19.pdb.gz	LMBL4_HUMAN Lethal(3)malignant brain tumor-like protein 4 OS=Homo sapiens OX=9606 GN=L3MBTL4 PE=1 SV=2
8	AFDB:Q9VB52	0.161	0.089	1.741E-23	1477	0.194	0.093	Q9VB52.pdb.gz	Q9VB52_DROME LD05287p OS=Drosophila melanogaster OX=7227 GN=l(3)mbt PE=1 SV=1
9	AFDB:Q9VHA0	0.148	0.122	5.681E-18	877	0.193	0.155	Q9VHA0.pdb.gz	SCM_DROME Polycomb protein Scm OS=Drosophila melanogaster OX=7227 GN=Scm PE=1 SV=2
10	AFDB:Q9UQR0	0.131	0.132	1.315E-17	700	0.132	0.133	Q9UQR0.pdb.gz	SCML2_HUMAN Sex comb on midleg-like protein 2 OS=Homo sapiens OX=9606 GN=SCML2 PE=1 SV=1
11	PDB:3mp8A	0.097	0.121	3.533E-3	513	0.044	0.060	3mp8A.pdb.gz	Sgf29 binds histone H3K4me2/3 and is required for SAGA complex recruitment and histone H3 acetylation
12	PDB:7okyZ	0.081	0.132	1.892E-2	374	0.043	0.080	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
13	PDB:2lqnA	0.062	0.129	2.502E-2	303	0.047	0.109	2lqnA.pdb.gz
14	PDB:7abi7	0.066	0.176	4.895E-2	236	0.024	0.072	7abi7.pdb.gz	Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.
15	PDB:6tedZ	0.078	0.101	1.013E-1	510	0.041	0.057	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
16	PDB:7rroT	0.073	0.103	1.675E-1	452	0.068	0.106	7rroT.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
17	PDB:7ungU	0.065	0.086	2.478E-1	485	0.079	0.115	7ungU.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
18	PDB:6ahsA	0.066	0.132	3.666E-1	224	0.024	0.076	6ahsA.pdb.gz	Discovery and structure-activity relationship of imidazolinylindole derivatives as kallikrein 7 inhibitors.
19	PDB:7aqkc	0.065	0.097	3.666E-1	372	0.027	0.051	7aqkc.pdb.gz
20	PDB:4zn3A	0.059	0.256	3.877E-1	147	0.020	0.095	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P59178	0.0	1222	703	0.909	0.912	LMBL2_MOUSE Lethal(3)malignant brain tumor-like protein 2 OS=Mus musculus OX=10090 GN=L3mbtl2 PE=1 SV=2
2	Q05BQ5	0.0	664	628	0.460	0.516	MBTD1_HUMAN MBT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MBTD1 PE=1 SV=2
3	Q6P5G3	0.0	669	631	0.464	0.518	MBTD1_MOUSE MBT domain-containing protein 1 OS=Mus musculus OX=10090 GN=Mbtd1 PE=1 SV=1
4	Q969R5	0.0	1464	705	1.000	1.000	LMBL2_HUMAN Lethal(3)malignant brain tumor-like protein 2 OS=Homo sapiens OX=9606 GN=L3MBTL2 PE=1 SV=1
5	Q9VK33	2.07e-143	451	1220	0.339	0.196	SMBT_DROME Polycomb protein Sfmbt OS=Drosophila melanogaster OX=7227 GN=Sfmbt PE=1 SV=2
6	Q5VUG0	3.52e-72	253	894	0.233	0.183	SMBT2_HUMAN Scm-like with four MBT domains protein 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1
7	A0A669KBL2	4.00e-72	253	893	0.233	0.184	A0A669KBL2_HUMAN Scm like with four mbt domains 2 OS=Homo sapiens OX=9606 GN=SFMBT2 PE=1 SV=1
8	Q9UHJ3	2.79e-68	242	866	0.233	0.189	SMBT1_HUMAN Scm-like with four MBT domains protein 1 OS=Homo sapiens OX=9606 GN=SFMBT1 PE=1 SV=2
9	Q9JMD1	1.21e-66	238	863	0.213	0.174	SMBT1_MOUSE Scm-like with four MBT domains protein 1 OS=Mus musculus OX=10090 GN=Sfmbt1 PE=1 SV=1
10	Q9Y468	2.78e-51	193	840	0.176	0.148	LMBL1_HUMAN Lethal(3)malignant brain tumor-like protein 1 OS=Homo sapiens OX=9606 GN=L3MBTL1 PE=1 SV=4
11	Q8NA19	6.75e-50	186	623	0.156	0.177	LMBL4_HUMAN Lethal(3)malignant brain tumor-like protein 4 OS=Homo sapiens OX=9606 GN=L3MBTL4 PE=1 SV=2
12	B2D6M2	1.75e-48	182	612	0.197	0.227	LIN61_CAEEL Protein lin-61 OS=Caenorhabditis elegans OX=6239 GN=lin-61 PE=1 SV=1
13	Q96JM7	4.62e-48	183	780	0.165	0.149	LMBL3_HUMAN Lethal(3)malignant brain tumor-like protein 3 OS=Homo sapiens OX=9606 GN=L3MBTL3 PE=1 SV=2
14	Q8BLB7	8.40e-46	177	883	0.157	0.126	LMBL3_MOUSE Lethal(3)malignant brain tumor-like protein 3 OS=Mus musculus OX=10090 GN=L3mbtl3 PE=1 SV=1
15	A0A571BDL9	9.98e-33	132	367	0.108	0.207	A0A571BDL9_MOUSE Scm polycomb group protein like 2 (Fragment) OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
16	E9Q796	2.98e-31	133	901	0.108	0.084	E9Q796_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
17	B1AVB1	3.04e-31	132	825	0.108	0.092	B1AVB1_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
18	B1AVB5	3.13e-31	133	905	0.108	0.084	B1AVB5_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
19	B1AVB2	3.33e-31	132	827	0.108	0.092	B1AVB2_MOUSE Scm polycomb group protein like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=1 SV=1
20	Q8BYC8	3.42e-31	132	845	0.108	0.090	Q8BYC8_MOUSE Scm polycomb group protein-like 2 OS=Mus musculus OX=10090 GN=Scml2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02820 MBT	3.7e-91	310.8	mbt repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216237

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358862	0.997	Polycomb group RING finger protein 6
2	9606.ENSP00000370936	0.993	Transcription factor E2F6
3	9606.ENSP00000419494	0.979	RING1 and YY1-binding protein
4	9606.ENSP00000356480	0.974	E3 ubiquitin-protein ligase RING2
5	9606.ENSP00000336687	0.973	Chromobox protein homolog 3
6	9606.ENSP00000363787	0.966	E3 ubiquitin-protein ligase RING1
7	9606.ENSP00000328004	0.963	YY1 associated factor 2, isoform CRA_d
8	9606.ENSP00000219905	0.947	MAX gene-associated protein
9	9606.ENSP00000249636	0.932	E3 SUMO-protein ligase PIAS1
10	9606.ENSP00000364519	0.929	Transcription factor Dp-1
11	9606.ENSP00000405965	0.921	Small ubiquitin-related modifier 2
12	9606.ENSP00000393139	0.920	Cell division cycle 7-related protein kinase
13	9606.ENSP00000348056	0.918	SUMO-conjugating enzyme UBC9
14	9606.ENSP00000345571	0.911	Transcription factor E2F1
15	9606.ENSP00000351490	0.910	Protein max
16	9606.ENSP00000337393	0.907	Protein UXT
17	9606.ENSP00000351446	0.842	WD repeat-containing protein 5
18	9606.ENSP00000417980	0.818	Histone-lysine N-methyltransferase EHMT1
19	9606.ENSP00000364678	0.808	Histone-lysine N-methyltransferase EHMT2
20	9606.ENSP00000251900	0.800	Sex comb on midleg-like protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0035064	1.000	methylated histone binding
GO:0003682	0.779	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0080090	0.998	regulation of primary metabolic process
GO:0051171	0.998	regulation of nitrogen compound metabolic process
GO:0060255	0.997	regulation of macromolecule metabolic process
GO:0031323	0.996	regulation of cellular metabolic process
GO:0009987	0.991	cellular process
GO:0051172	0.988	negative regulation of nitrogen compound metabolic process
GO:0010468	0.979	regulation of gene expression
GO:0051173	0.976	positive regulation of nitrogen compound metabolic process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0031325	0.960	positive regulation of cellular metabolic process
GO:0010605	0.950	negative regulation of macromolecule metabolic process
GO:0051246	0.927	regulation of protein metabolic process
GO:0019219	0.846	regulation of nucleobase-containing compound metabolic process
GO:0031056	0.810	regulation of histone modification
GO:0032502	0.803	developmental process
GO:0048856	0.678	anatomical structure development
GO:0031326	0.671	regulation of cellular biosynthetic process
GO:1901983	0.662	regulation of protein acetylation
GO:0071704	0.623	organic substance metabolic process
GO:0044238	0.621	primary metabolic process
GO:0031060	0.619	regulation of histone methylation
GO:0010556	0.610	regulation of macromolecule biosynthetic process
GO:0051252	0.596	regulation of RNA metabolic process
GO:0048523	0.585	negative regulation of cellular process
GO:0006355	0.579	regulation of DNA-templated transcription
GO:0006807	0.575	nitrogen compound metabolic process
GO:0043170	0.466	macromolecule metabolic process
GO:0036211	0.416	protein modification process
GO:0051247	0.400	positive regulation of protein metabolic process
GO:0031324	0.392	negative regulation of cellular metabolic process
GO:0031327	0.305	negative regulation of cellular biosynthetic process
GO:0044237	0.301	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0032991	0.725	protein-containing complex
GO:0043232	0.316	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]