StarFunc result for job id Q969S3

User Input

>input (477 residues)
MATYTCITCRVAFRDADMQRAHYKTDWHRYNLRRKVASMAPVTAEGFQERVRAQRAVAEE
ESKGSATYCTVCSKKFASFNAYENHLKSRRHVELEKKAVQAVNRKVEMMNEKNLEKGLGV
DSVDKDAMNAAIQQAIKAQPSMSPKKAPPAPAKEARNVVAVGTGGRGTHDRDPSEKPPRL
QWFEQQAKKLAKQQEEDSEEEEEDLDGDDWEDIDSDEELECEDTEAMDDVVEQDAEEEEA
EEGPPLGAIPITDCLFCSHHSSSLMKNVAHMTKDHSFFIPDIEYLSDIKGLIKYLGEKVG
VGKICLWCNEKGKSFYSTEAVQAHMNDKSHCKLFTDGDAALEFADFYDFRSSYPDHKEGE
DPNKAEELPSEKNLEYDDETMELILPSGARVGHRSLMRYYKQRFGLSRAVAVAKNRKAVG
RVLQQYRALGWTGSTGAALMRERDMQYVQRMKSKWMLKTGMKNNATKQMHFRVQVRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969S3	1.000	1.000	2.259E-83	477	1.000	1.000	Q969S3.pdb.gz	ZN622_HUMAN Cytoplasmic 60S subunit biogenesis factor ZNF622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1
2	AFDB:O59811	0.301	0.310	1.177E-29	463	0.294	0.302	O59811.pdb.gz	REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.15c PE=1 SV=1
3	AFDB:F4JS04	0.283	0.329	3.707E-25	405	0.260	0.306	F4JS04.pdb.gz	F4JS04_ARATH Zinc finger protein 622 OS=Arabidopsis thaliana OX=3702 GN=REIL1 PE=1 SV=1
4	AFDB:Q9ZQ18	0.293	0.348	6.793E-25	395	0.285	0.344	Q9ZQ18.pdb.gz	REIL2_ARATH Cytoplasmic 60S subunit biogenesis factor REI1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=REIL2 PE=1 SV=1
5	AFDB:P38344	0.308	0.369	2.147E-24	393	0.256	0.310	P38344.pdb.gz	REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REI1 PE=1 SV=3
6	PDB:6lsr0	0.268	0.643	2.916E-23	190	0.398	1.000	6lsr0.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
7	AFDB:Q06709	0.313	0.338	3.691E-20	432	0.231	0.255	Q06709.pdb.gz	REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REH1 PE=1 SV=1
8	AFDB:Q584Z4	0.253	0.319	8.604E-18	366	0.191	0.249	Q584Z4.pdb.gz	Q584Z4_TRYB2 Zinc finger protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.190 PE=4 SV=1
9	PDB:5apny	0.274	0.587	2.408E-12	211	0.149	0.336	5apny.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.
10	AFDB:E7FE25	0.120	0.129	4.113E-5	439	0.149	0.162	E7FE25.pdb.gz
11	AFDB:E9QJ33	0.129	0.134	3.225E-4	459	0.119	0.124	E9QJ33.pdb.gz	E9QJ33_DANRE Zinc finger protein 385C OS=Danio rerio OX=7955 GN=znf385c PE=4 SV=2
12	AFDB:F4K209	0.095	0.049	1.151E-3	995	0.147	0.070	F4K209.pdb.gz	F4K209_ARATH Endonuclease or glycosyl hydrolase with C2H2-type zinc finger domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=MAF19.19 PE=1 SV=1
13	PDB:6qx91C	0.091	0.743	9.044E-1	50	0.021	0.200	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
14	PDB:3w5kB	0.044	0.181	9.608E-1	110	0.027	0.118	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
15	PDB:5o9zQ	0.098	0.505	1.085	75	0.038	0.240	5o9zQ.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
16	PDB:5nrlU	0.083	0.198	1.657	196	0.015	0.036	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
17	PDB:7evoC	0.077	0.086	1.761	422	0.029	0.033	7evoC.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
18	PDB:7pt6I	0.076	0.103	1.761	341	0.034	0.047	7pt6I.pdb.gz	The structural basis of Cdc7-Dbf4 kinase dependent targeting and phosphorylation of the MCM2-7 double hexamer.
19	PDB:6n7pB	0.086	0.206	2.244	195	0.027	0.067	6n7pB.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
20	PDB:6n7rI	0.078	0.216	2.244	147	0.029	0.095	6n7rI.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q969S3	0.0	1002	477	1.000	1.000	ZN622_HUMAN Cytoplasmic 60S subunit biogenesis factor ZNF622 OS=Homo sapiens OX=9606 GN=ZNF622 PE=1 SV=1
2	P38344	1.01e-34	135	393	0.151	0.183	REI1_YEAST Cytoplasmic 60S subunit biogenesis factor REI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REI1 PE=1 SV=3
3	O59811	8.15e-32	129	463	0.191	0.197	REI1_SCHPO Cytoplasmic 60S subunit biogenesis factor SPCC550.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC550.15c PE=1 SV=1
4	Q9ZQ18	4.95e-30	122	395	0.172	0.208	REIL2_ARATH Cytoplasmic 60S subunit biogenesis factor REI1 homolog 2 OS=Arabidopsis thaliana OX=3702 GN=REIL2 PE=1 SV=1
5	Q8H1G5	3.58e-29	120	404	0.193	0.228	REIL1_ARATH Cytoplasmic 60S subunit biogenesis factor REI1 homolog 1 OS=Arabidopsis thaliana OX=3702 GN=REIL1 PE=1 SV=1
6	F4JS04	1.63e-27	115	405	0.193	0.227	F4JS04_ARATH Zinc finger protein 622 OS=Arabidopsis thaliana OX=3702 GN=REIL1 PE=1 SV=1
7	Q06709	2.32e-25	110	432	0.231	0.255	REH1_YEAST Cytoplasmic 60S subunit biogenesis factor REH1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=REH1 PE=1 SV=1
8	Q584Z4	2.49e-21	97.4	366	0.189	0.246	Q584Z4_TRYB2 Zinc finger protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.2N9.190 PE=4 SV=1
9	O74977	9.58e-05	47.4	600	0.031	0.025	VMS1_SCHPO tRNA endonuclease vms1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vms1 PE=1 SV=1
10	Q9MAR2	6.68e-04	44.3	370	0.034	0.043	Q9MAR2_ARATH At1g43860 OS=Arabidopsis thaliana OX=3702 GN=At1g43860 PE=1 SV=1
11	Q80UU1	0.001	43.9	748	0.034	0.021	ANKZ1_MOUSE tRNA endonuclease ANKZF1 OS=Mus musculus OX=10090 GN=Ankzf1 PE=1 SV=2
12	Q9H8Y5	0.001	44.3	726	0.036	0.023	ANKZ1_HUMAN tRNA endonuclease ANKZF1 OS=Homo sapiens OX=9606 GN=ANKZF1 PE=1 SV=1
13	Q04311	0.002	43.1	632	0.036	0.027	VMS1_YEAST tRNA endonuclease VMS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMS1 PE=1 SV=1
14	Q8AVN9	0.027	39.3	524	0.050	0.046	ZN346_XENLA Zinc finger protein 346 OS=Xenopus laevis OX=8355 GN=znf346 PE=1 SV=1
15	Q61329	0.095	38.1	3726	0.059	0.008	ZFHX3_MOUSE Zinc finger homeobox protein 3 OS=Mus musculus OX=10090 GN=Zfhx3 PE=1 SV=1
16	F1M4Q6	0.10	37.7	3730	0.059	0.008	F1M4Q6_RAT Zinc finger homeobox 3 OS=Rattus norvegicus OX=10116 GN=Zfhx3 PE=4 SV=3
17	Q15911	0.21	37.0	3703	0.057	0.007	ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens OX=9606 GN=ZFHX3 PE=1 SV=2
18	E9RKC7	0.23	36.6	764	0.088	0.055	E9RKC7_CAEEL DZF domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zfr-1 PE=1 SV=1
19	Q9C911	0.35	35.8	630	0.031	0.024	JJJ1_ARATH DNAJ protein JJJ1 homolog OS=Arabidopsis thaliana OX=3702 GN=JJJ1 PE=1 SV=1
20	E9Q6D6	0.39	35.8	583	0.075	0.062	ZN277_MOUSE Zinc finger protein 277 OS=Mus musculus OX=10090 GN=Znf277 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04780 DUF629	41	14.3	Protein of unknown function (DUF629)
2	PF12756 zf-C2H2_2	1.9e-31	119.7	C2H2 type zinc-finger (2 copies)
3	PF18868 zf-C2H2_3rep	4.1e+02	13.1	Zinc finger C2H2-type, 3 repeats
4	PF13894 zf-C2H2_4	1.1e+02	15.0	C2H2-type zinc finger
5	PF12171 zf-C2H2_jaz	1e-06	40.1	Zinc-finger double-stranded RNA-binding
6	PF07535 zf-DBF	52	15.4	DBF zinc finger
7	PF08790 zf-LYAR	7.1e+02	11.5	LYAR-type C2HC zinc finger
8	PF12874 zf-met	0.26	23.0	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310042

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419004	0.995	60S ribosomal export protein NMD3
2	9606.ENSP00000363574	0.994	Eukaryotic translation initiation factor 6
3	9606.ENSP00000265245	0.985	Large subunit GTPase 1 homolog
4	9606.ENSP00000302886	0.979	Proliferation-associated protein 2G4
5	9606.ENSP00000483484	0.955	Ribosome biogenesis protein NSA2 homolog
6	9606.ENSP00000371451	0.953	DnaJ homolog subfamily C member 21
7	9606.ENSP00000377640	0.945	Ribosomal protein L24
8	9606.ENSP00000298048	0.944	Maternal embryonic leucine zipper kinase
9	9606.ENSP00000364320	0.943	mRNA turnover protein 4 homolog
10	9606.ENSP00000346088	0.930	Ribosomal protein L22
11	9606.ENSP00000254940	0.917	60S ribosome subunit biogenesis protein NIP7 homolog
12	9606.ENSP00000353246	0.916	Protein MAK16 homolog
13	9606.ENSP00000260443	0.912	Probable ribosome biogenesis protein RLP24
14	9606.ENSP00000389103	0.912	60S ribosomal protein L23a
15	9606.ENSP00000322396	0.907	Ribosome biogenesis regulatory protein homolog
16	9606.ENSP00000420311	0.907	Ribosomal protein L23
17	9606.ENSP00000346001	0.903	60S ribosomal protein L3
18	9606.ENSP00000217026	0.901	Myb-related protein B
19	9606.ENSP00000397798	0.894	60S ribosomal protein L17
20	9606.ENSP00000418868	0.893	60S ribosomal protein L29

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043021	1.000	ribonucleoprotein complex binding
GO:0003723	1.000	RNA binding
GO:1990275	0.917	preribosome binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0042254	0.960	ribosome biogenesis
GO:0065007	0.957	biological regulation
GO:0050794	0.946	regulation of cellular process
GO:0042273	0.929	ribosomal large subunit biogenesis
GO:0048518	0.918	positive regulation of biological process
GO:0019222	0.910	regulation of metabolic process
GO:0031323	0.825	regulation of cellular metabolic process
GO:0048522	0.746	positive regulation of cellular process
GO:0071704	0.585	organic substance metabolic process
GO:0050896	0.531	response to stimulus
GO:0043170	0.475	macromolecule metabolic process
GO:1902531	0.431	regulation of intracellular signal transduction
GO:0010941	0.419	regulation of cell death
GO:0009893	0.417	positive regulation of metabolic process
GO:0036473	0.411	cell death in response to oxidative stress
GO:0065009	0.388	regulation of molecular function
GO:0031325	0.374	positive regulation of cellular metabolic process
GO:0044238	0.371	primary metabolic process
GO:0050790	0.369	regulation of catalytic activity
GO:0044237	0.366	cellular metabolic process
GO:0006807	0.357	nitrogen compound metabolic process
GO:0043067	0.355	regulation of programmed cell death
GO:0012501	0.352	programmed cell death
GO:0080135	0.345	regulation of cellular response to stress
GO:0043408	0.339	regulation of MAPK cascade
GO:0010942	0.338	positive regulation of cell death
GO:0042981	0.337	regulation of apoptotic process
GO:0043068	0.328	positive regulation of programmed cell death
GO:0009967	0.319	positive regulation of signal transduction
GO:0019220	0.315	regulation of phosphate metabolic process
GO:0046328	0.315	regulation of JNK cascade
GO:0043065	0.313	positive regulation of apoptotic process
GO:0097193	0.313	intrinsic apoptotic signaling pathway
GO:0010467	0.311	gene expression
GO:0033674	0.307	positive regulation of kinase activity
GO:0046330	0.307	positive regulation of JNK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0005730	0.996	nucleolus
GO:0012505	0.994	endomembrane system
GO:0005794	0.943	Golgi apparatus
GO:0016020	0.359	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]