StarFunc result for job id Q969S8

User Input

>input (669 residues)
MGTALVYHEDMTATRLLWDDPECEIERPERLTAALDRLRQRGLEQRCLRLSAREASEEEL
GLVHSPEYVSLVRETQVLGKEELQALSGQFDAIYFHPSTFHCARLAAGAGLQLVDAVLTG
AVQNGLALVRPPGHHGQRAAANGFCVFNNVAIAAAHAKQKHGLHRILVVDWDVHHGQGIQ
YLFEDDPSVLYFSWHRYEHGRFWPFLRESDADAVGRGQGLGFTVNLPWNQVGMGNADYVA
AFLHLLLPLAFEFDPELVLVSAGFDSAIGDPEGQMQATPECFAHLTQLLQVLAGGRVCAV
LEGGYHLESLAESVCMTVQTLLGDPAPPLSGPMAPCQSALESIQSARAAQAPHWKSLQQQ
DVTAVPMSPSSHSPEGRPPPLLPGGPVCKAAASAPSSLLDQPCLCPAPSVRTAVALTTPD
ITLVLPPDVIQQEASALREETEAWARPHESLAREEALTALGKLLYLLDGMLDGQVNSGIA
ATPASAAAATLDVAVRRGLSHGAQRLLCVALGQLDRPPDLAHDGRSLWLNIRGKEAAALS
MFHVSTPLPVMTGGFLSCILGLVLPLAYGFQPDLVLVALGPGHGLQGPHAALLAAMLRGL
AGGRVLALLEENSTPQLAGILARVLNGEAPPSLGPSSVASPEDVQALMYLRGQLEPQWKM
LQCHPHLVA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q969S8	1.000	1.000	0.000	669	1.000	1.000	Q969S8.pdb.gz	HDA10_HUMAN Polyamine deacetylase HDAC10 OS=Homo sapiens OX=9606 GN=HDAC10 PE=1 SV=1
2	AFDB:Q569C4	0.806	0.915	7.336E-81	588	0.646	0.735	Q569C4.pdb.gz	HDA10_RAT Polyamine deacetylase HDAC10 OS=Rattus norvegicus OX=10116 GN=Hdac10 PE=2 SV=1
3	AFDB:F1QCV2	0.920	0.912	1.543E-75	675	0.447	0.443	F1QCV2.pdb.gz	HDA10_DANRE Polyamine deacetylase HDAC10 OS=Danio rerio OX=7955 GN=hdac10 PE=1 SV=2
4	PDB:7sggA	0.897	0.931	3.986E-69	644	0.450	0.467	7sggA.pdb.gz	Aza-SAHA Derivatives Are Selective Histone Deacetylase 10 Chemical Probes That Inhibit Polyamine Deacetylation and Phenocopy HDAC10 Knockout.
5	PDB:6uijA	0.875	0.944	7.413E-68	620	0.441	0.476	6uijA.pdb.gz	Binding ofN8-Acetylspermidine Analogues to Histone Deacetylase 10 Reveals Molecular Strategies for Blocking Polyamine Deacetylation.
6	AFDB:D3ZVD8	0.828	0.487	1.164E-60	1155	0.410	0.237	D3ZVD8.pdb.gz	D3ZVD8_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=3
7	AFDB:F8W4B7	0.820	0.515	4.893E-60	1081	0.390	0.241	F8W4B7.pdb.gz	F8W4B7_DANRE Histone deacetylase 6 OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
8	AFDB:A0A024QZ26	0.828	0.465	1.763E-59	1215	0.405	0.223	A0A024QZ26.pdb.gz
9	AFDB:Q8IR37	0.864	0.519	2.302E-57	1138	0.390	0.229	Q8IR37.pdb.gz	Q8IR37_DROME Histone deacetylase 6 isoform C OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
10	PDB:5eduB	0.522	0.483	7.301E-41	723	0.280	0.259	5eduB.pdb.gz	Histone deacetylase 6 structure and molecular basis of catalysis and inhibition.
11	AFDB:F4K1Z5	0.514	0.517	1.773E-38	664	0.232	0.233	F4K1Z5.pdb.gz	F4K1Z5_ARATH Histone deacetylase 5 OS=Arabidopsis thaliana OX=3702 GN=HDA05 PE=1 SV=1
12	AFDB:P56523	0.530	0.516	3.280E-38	687	0.272	0.265	P56523.pdb.gz	CLR3_SCHPO Histone deacetylase clr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr3 PE=1 SV=1
13	AFDB:P53973	0.521	0.494	3.825E-38	706	0.248	0.235	P53973.pdb.gz	HDA1_YEAST Histone deacetylase HDA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=HDA1 PE=1 SV=1
14	PDB:6z6fB	0.521	0.527	9.830E-33	661	0.248	0.251	6z6fB.pdb.gz	Structural basis for the regulation of nucleosome recognition and HDAC activity by histone deacetylase assemblies.
15	PDB:5ikkA	0.448	0.503	2.245E-31	594	0.248	0.279	5ikkA.pdb.gz	SHREC Silences Heterochromatin via Distinct Remodeling and Deacetylation Modules.
16	PDB:5g0yB	0.432	0.755	3.672E-25	377	0.166	0.294	5g0yB.pdb.gz	Crystal Structure of a Histone Deacetylase Homologue from Pseudomonas aeruginosa.
17	PDB:3sfhA	0.396	0.751	2.291E-17	342	0.109	0.213	3sfhA.pdb.gz	Human HDAC isoform selectivity achieved via exploitation of the acetate release channel with structurally unique small molecule inhibitors.
18	PDB:4qa0A	0.427	0.755	2.672E-17	371	0.112	0.202	4qa0A.pdb.gz	Compromised Structure and Function of HDAC8 Mutants Identified in Cornelia de Lange Syndrome Spectrum Disorders.
19	PDB:7zzuB	0.430	0.760	1.245E-16	371	0.102	0.183	7zzuB.pdb.gz	Fragment-Based Discovery of a Novel, Brain Penetrant, Orally Active HDAC2 Inhibitor.
20	PDB:6dktE	0.193	0.409	1.552E-3	268	0.051	0.127	6dktE.pdb.gz	Structure of Arginase from Bacillus subtilis at 2.08 Angstroms resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1QCV2	0.0	571	675	0.462	0.458	HDA10_DANRE Polyamine deacetylase HDAC10 OS=Danio rerio OX=7955 GN=hdac10 PE=1 SV=2
2	Q569C4	0.0	761	588	0.653	0.743	HDA10_RAT Polyamine deacetylase HDAC10 OS=Rattus norvegicus OX=10116 GN=Hdac10 PE=2 SV=1
3	Q969S8	0.0	1340	669	1.000	1.000	HDA10_HUMAN Polyamine deacetylase HDAC10 OS=Homo sapiens OX=9606 GN=HDAC10 PE=1 SV=1
4	F8W4B7	6.43e-132	417	1081	0.288	0.179	F8W4B7_DANRE Histone deacetylase 6 OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
5	A0A1L5YJQ7	3.37e-131	416	1152	0.291	0.169	A0A1L5YJQ7_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=2 SV=1
6	D3ZVD8	1.18e-130	416	1189	0.291	0.164	D3ZVD8_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=3
7	A0A0G2QC41	4.46e-129	411	1157	0.291	0.169	A0A0G2QC41_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=2
8	A0A2R8YDE6	7.60e-128	408	1160	0.291	0.168	A0A2R8YDE6_HUMAN Histone deacetylase 6 OS=Homo sapiens OX=9606 GN=HDAC6 PE=1 SV=1
9	Q9UBN7	1.87e-127	408	1215	0.291	0.160	HDAC6_HUMAN Histone deacetylase 6 OS=Homo sapiens OX=9606 GN=HDAC6 PE=1 SV=2
10	Q9Z2V5	7.54e-125	399	1149	0.281	0.164	HDAC6_MOUSE Histone deacetylase 6 OS=Mus musculus OX=10090 GN=Hdac6 PE=1 SV=3
11	A0A8I6GM68	8.36e-125	400	1183	0.291	0.165	A0A8I6GM68_RAT Histone deacetylase 6 OS=Rattus norvegicus OX=10116 GN=Hdac6 PE=1 SV=1
12	Q9XYX1	1.38e-115	369	883	0.274	0.207	Q9XYX1_DROME HDAC6 OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
13	M9NEH6	1.38e-114	369	1022	0.274	0.179	M9NEH6_DROME Histone deacetylase 6, isoform F OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
14	M9NGF7	7.16e-114	369	1108	0.274	0.165	M9NGF7_DROME Histone deacetylase 6, isoform E OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
15	Q86NK9	1.07e-113	369	1128	0.274	0.162	Q86NK9_DROME Histone deacetylase 6 isoform A OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
16	Q8IR37	1.14e-113	369	1138	0.274	0.161	Q8IR37_DROME Histone deacetylase 6 isoform C OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
17	Q8IR38	1.48e-113	369	1135	0.274	0.161	Q8IR38_DROME Histone deacetylase 6 isoform B OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
18	M9PJN5	2.34e-113	369	1179	0.274	0.155	M9PJN5_DROME Histone deacetylase 6, isoform G OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
19	A7YT55	8.98e-105	341	929	0.230	0.166	A7YT55_DANRE Hdac6 protein (Fragment) OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
20	P56523	3.30e-89	294	687	0.223	0.217	CLR3_SCHPO Histone deacetylase clr3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=clr3 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00850 Hist_deacetyl	3.1e-84	294.6	Histone deacetylase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216271

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000332194	0.937	Histone H2A type 2-C
2	9606.ENSP00000358151	0.937	Histone H2B type 2-E
3	9606.ENSP00000355656	0.920	Histone H2A type 3
4	9606.ENSP00000349430	0.918	Histone H2B type 1-K
5	9606.ENSP00000367022	0.917	Histone H2A type 1-C
6	9606.ENSP00000476136	0.916	Histone H2B type 1-J
7	9606.ENSP00000274764	0.915	Histone H2B type 1-A
8	9606.ENSP00000289316	0.915	Histone H2B type 1-D
9	9606.ENSP00000366618	0.915	Histone H2B type 1-L
10	9606.ENSP00000445831	0.915	Histone H2B type 2-F
11	9606.ENSP00000477527	0.915	Histone H2B type 1-O
12	9606.ENSP00000477907	0.915	Histone H2B type 1-M
13	9606.ENSP00000479169	0.915	Histone H2B type 1-H
14	9606.ENSP00000482674	0.915	Histone H2B type 1-B
15	9606.ENSP00000483903	0.915	Histone H2B type 1-N
16	9606.ENSP00000297012	0.914	Histone H2A type 1-A
17	9606.ENSP00000332790	0.914	Histone H2A type 2-B
18	9606.ENSP00000366679	0.914	Histone H2A type 1-H
19	9606.ENSP00000328484	0.913	Histone H2A type 1-J
20	9606.ENSP00000341094	0.913	Histone H2A type 1-D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004407	1.000	histone deacetylase activity
GO:0042826	0.999	histone deacetylase binding
GO:0140297	0.500	DNA-binding transcription factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.992	organic substance metabolic process
GO:0019222	0.991	regulation of metabolic process
GO:0009987	0.990	cellular process
GO:0006807	0.985	nitrogen compound metabolic process
GO:0050794	0.984	regulation of cellular process
GO:0044238	0.982	primary metabolic process
GO:0043170	0.977	macromolecule metabolic process
GO:0080090	0.970	regulation of primary metabolic process
GO:0031323	0.970	regulation of cellular metabolic process
GO:0043412	0.967	macromolecule modification
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:1901564	0.941	organonitrogen compound metabolic process
GO:0098732	0.889	macromolecule deacylation
GO:0010468	0.856	regulation of gene expression
GO:0031326	0.839	regulation of cellular biosynthetic process
GO:0019219	0.836	regulation of nucleobase-containing compound metabolic process
GO:0048519	0.793	negative regulation of biological process
GO:0019538	0.776	protein metabolic process
GO:0036211	0.761	protein modification process
GO:0010556	0.738	regulation of macromolecule biosynthetic process
GO:0048518	0.703	positive regulation of biological process
GO:0051252	0.692	regulation of RNA metabolic process
GO:1903506	0.650	regulation of nucleic acid-templated transcription
GO:0006355	0.640	regulation of DNA-templated transcription
GO:0048523	0.619	negative regulation of cellular process
GO:0044237	0.615	cellular metabolic process
GO:0048522	0.565	positive regulation of cellular process
GO:0009893	0.447	positive regulation of metabolic process
GO:0010605	0.443	negative regulation of macromolecule metabolic process
GO:0051173	0.435	positive regulation of nitrogen compound metabolic process
GO:0031324	0.432	negative regulation of cellular metabolic process
GO:0051172	0.429	negative regulation of nitrogen compound metabolic process
GO:0031325	0.424	positive regulation of cellular metabolic process
GO:0010604	0.412	positive regulation of macromolecule metabolic process
GO:0045934	0.401	negative regulation of nucleobase-containing compound metabolic process
GO:0045935	0.372	positive regulation of nucleobase-containing compound metabolic process
GO:0006357	0.358	regulation of transcription by RNA polymerase II
GO:0031327	0.357	negative regulation of cellular biosynthetic process
GO:0016570	0.353	histone modification
GO:0050896	0.350	response to stimulus
GO:0010558	0.350	negative regulation of macromolecule biosynthetic process
GO:0071840	0.323	cellular component organization or biogenesis
GO:0051253	0.323	negative regulation of RNA metabolic process
GO:0048583	0.318	regulation of response to stimulus
GO:0016043	0.308	cellular component organization
GO:0035601	0.304	protein deacylation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0140513	0.941	nuclear protein-containing complex
GO:1902494	0.937	catalytic complex
GO:0000118	0.835	histone deacetylase complex
GO:0005829	0.418	cytosol
GO:0043232	0.342	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:58196	1.000	H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone]
EC:3.5.1.98	1.000	histone deacetylase.

[back to server]