StarFunc result for job id Q969S9

User Input

>input (779 residues)
MLTNLRIFAMSHQTIPSVYINNICCYKIRASLKRLKPHVPLGRNCSSLPGLIGNDIKSLH
SIINPPIAKIRNIGIMAHIDAGKTTTTERILYYSGYTRSLGDVDDGDTVTDFMAQERERG
ITIQSAAVTFDWKGYRVNLIDTPGHVDFTLEVERCLRVLDGAVAVFDASAGVEAQTLTVW
RQADKHNIPRICFLNKMDKTGASFKYAVESIREKLKAKPLLLQLPIGEAKTFKGVVDVVM
KEKLLWNCNSNDGKDFERKPLLEMNDPELLKETTEARNALIEQVADLDDEFADLVLEEFS
ENFDLLPAEKLQTAIHRVTLAQTAVPVLCGSALKNKGIQPLLDAVTMYLPSPEERNYEFL
QWYKDDLCALAFKVLHDKQRGPLVFMRIYSGTIKPQLAIHNINGNCTERISRLLLPFADQ
HVEIPSLTAGNIALTVGLKHTATGDTIVSSKSSALAAARRAEREGEKKHRQNNEAERLLL
AGVEIPEPVFFCTIEPPSLSKQPDLEHALKCLQREDPSLKVRLDPDSGQTVLCGMGELHI
EIIHDRIKREYGLETYLGPLQVAYRETILNSVRATDTLDRTLGDKRHLVTVEVEARPIET
SSVMPVIEFEYAESINEGLLKVSQEAIENGIHSACLQGPLLGSPIQDVAITLHSLTIHPG
TSTTMISACVSRCVQKALKKADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQT
RQDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNTLLNRRSGLT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7nshBC	0.633	0.700	0.000	700	0.897	0.999	7nshBC.pdb.gz	Structural basis of translation termination, rescue, and recycling in mammalian mitochondria.
2	AFDB:Q8R2Q4	0.926	0.926	0.000	779	0.843	0.843	Q8R2Q4.pdb.gz	RRF2M_MOUSE Ribosome-releasing factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Gfm2 PE=1 SV=2
3	AFDB:Q969S9	1.000	1.000	0.000	779	1.000	1.000	Q969S9.pdb.gz	RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=GFM2 PE=1 SV=1
4	AFDB:P13551	0.597	0.668	1.427E-86	691	0.371	0.418	P13551.pdb.gz	EFG_THETH Elongation factor G OS=Thermus thermophilus OX=274 GN=fusA PE=1 SV=1
5	AFDB:Q9SI75	0.611	0.608	3.810E-86	783	0.366	0.364	Q9SI75.pdb.gz	EFGC_ARATH Elongation factor G, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPEFG PE=1 SV=1
6	AFDB:Q2G0N1	0.607	0.678	1.913E-83	693	0.350	0.394	Q2G0N1.pdb.gz	EFG_STAA8 Elongation factor G OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fusA PE=1 SV=3
7	AFDB:P9WNM7	0.682	0.748	2.380E-83	701	0.350	0.389	P9WNM7.pdb.gz	EFG_MYCTU Elongation factor G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fusA PE=1 SV=1
8	AFDB:P25039	0.793	0.811	1.486E-80	761	0.315	0.322	P25039.pdb.gz	EFGM_YEAST Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEF1 PE=1 SV=2
9	AFDB:F4IW10	0.605	0.624	4.673E-80	754	0.327	0.338	F4IW10.pdb.gz	EFGM2_ARATH Elongation factor G-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG2 PE=1 SV=1
10	AFDB:Q9USZ1	0.764	0.773	7.230E-80	770	0.331	0.335	Q9USZ1.pdb.gz	EFGM_SCHPO Elongation factor G, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mef1 PE=3 SV=2
11	AFDB:P28371	0.622	0.691	9.498E-80	695	0.326	0.365	P28371.pdb.gz	EFG1_SYNY3 Elongation factor G 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=fusA PE=1 SV=2
12	PDB:7cdwA	0.522	0.580	1.238E-70	683	0.338	0.385	7cdwA.pdb.gz	Crystal Structure of Mycobacterium tuberculosis Elongation Factor G1.
13	PDB:2bv3A	0.536	0.645	7.734E-68	632	0.335	0.413	2bv3A.pdb.gz	Crystal Structure of a Mutant Elongation Factor G Trapped with a GTP Analogue.
14	PDB:7pjvx	0.599	0.656	7.734E-68	703	0.349	0.387	7pjvx.pdb.gz	Structural mechanism of GTPase-powered ribosome-tRNA movement.
15	PDB:6vlzv	0.583	0.634	2.824E-61	712	0.322	0.353	6vlzv.pdb.gz	Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
16	PDB:1jqmB	0.472	0.524	6.533E-58	691	0.375	0.423	1jqmB.pdb.gz
17	PDB:3jb9B	0.648	0.565	6.408E-42	904	0.204	0.176	3jb9B.pdb.gz	Structure of a yeast spliceosome at 3.6-angstrom resolution
18	PDB:7dvqC	0.621	0.543	7.791E-40	902	0.211	0.182	7dvqC.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:6j6gC	0.637	0.546	2.080E-39	920	0.199	0.168	6j6gC.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
20	PDB:5lj3C	0.627	0.559	1.802E-36	882	0.196	0.173	5lj3C.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R2Q4	0.0	1302	779	0.842	0.842	RRF2M_MOUSE Ribosome-releasing factor 2, mitochondrial OS=Mus musculus OX=10090 GN=Gfm2 PE=1 SV=2
2	Q969S9	0.0	1610	779	1.000	1.000	RRF2M_HUMAN Ribosome-releasing factor 2, mitochondrial OS=Homo sapiens OX=9606 GN=GFM2 PE=1 SV=1
3	P13551	6.69e-179	531	691	0.380	0.428	EFG_THETH Elongation factor G OS=Thermus thermophilus OX=274 GN=fusA PE=1 SV=1
4	Q2G0N1	6.28e-157	474	693	0.352	0.395	EFG_STAA8 Elongation factor G OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=fusA PE=1 SV=3
5	P9WNM7	2.43e-154	468	701	0.354	0.394	EFG_MYCTU Elongation factor G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=fusA PE=1 SV=1
6	P0A6M8	6.72e-151	459	704	0.352	0.389	EFG_ECOLI Elongation factor G OS=Escherichia coli (strain K12) OX=83333 GN=fusA PE=1 SV=2
7	Q9SI75	1.84e-150	461	783	0.371	0.369	EFGC_ARATH Elongation factor G, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CPEFG PE=1 SV=1
8	P28371	1.89e-137	424	695	0.335	0.376	EFG1_SYNY3 Elongation factor G 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=fusA PE=1 SV=2
9	O94429	4.85e-136	424	813	0.354	0.339	RRF2M_SCHPO Ribosome-releasing factor 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mef2 PE=3 SV=1
10	P39677	5.56e-136	424	819	0.359	0.342	RRF2M_YEAST Ribosome-releasing factor 2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEF2 PE=1 SV=1
11	Q9C641	4.50e-129	404	754	0.331	0.342	EFGM1_ARATH Elongation factor G-1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG1 PE=1 SV=1
12	Q9USZ1	2.32e-128	402	770	0.340	0.344	EFGM_SCHPO Elongation factor G, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mef1 PE=3 SV=2
13	Q8K0D5	3.30e-127	399	751	0.334	0.346	EFGM_MOUSE Elongation factor G, mitochondrial OS=Mus musculus OX=10090 GN=Gfm1 PE=1 SV=1
14	F4IW10	4.67e-127	399	754	0.329	0.340	EFGM2_ARATH Elongation factor G-2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MEFG2 PE=1 SV=1
15	E1BEJ3	5.00e-127	399	753	0.335	0.347	E1BEJ3_BOVIN Elongation factor G, mitochondrial OS=Bos taurus OX=9913 GN=GFM1 PE=3 SV=2
16	Q96RP9	4.90e-125	393	751	0.331	0.344	EFGM_HUMAN Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1 PE=1 SV=2
17	P25039	3.74e-121	384	761	0.332	0.340	EFGM_YEAST Elongation factor G, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MEF1 PE=1 SV=2
18	O30913	2.07e-117	372	693	0.315	0.354	EFG1_BORBU Elongation factor G 1 OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=fusA PE=3 SV=2
19	Q9VM33	4.66e-117	372	745	0.317	0.332	EFGM_DROME Elongation factor G, mitochondrial OS=Drosophila melanogaster OX=7227 GN=mEFG1 PE=2 SV=2
20	Q38BA0	4.74e-107	346	746	0.307	0.320	Q38BA0_TRYB2 Elongation factor G, mitochondrial OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.2190 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04548 AIG1	1.1e+02	13.5	AIG1 family
2	PF16847 AvrPtoB_bdg	4.9	19.0	Avirulence AvrPtoB, BAK1-binding domain
3	PF00679 EFG_C	5e-20	82.7	Elongation factor G C-terminus
4	PF14492 EFG_III	3.2e-24	96.1	Elongation Factor G, domain III
5	PF03764 EFG_IV	8.9e-08	43.4	Elongation factor G, domain IV
6	PF02421 FeoB_N	1.7e+02	13.1	Ferrous iron transport protein B
7	PF00009 GTP_EFTU	1.1e-63	225.8	Elongation factor Tu GTP binding domain
8	PF03144 GTP_EFTU_D2	4.8e-05	35.0	Elongation factor Tu domain 2
9	PF01926 MMR_HSR1	0.33	22.4	50S ribosome-binding GTPase
10	PF16658 RF3_C	0.0024	29.1	Class II release factor RF3, C-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000296805

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000343867	0.956	Ribosome-recycling factor, mitochondrial
2	9606.ENSP00000379057	0.902	Mitochondrial dynamics protein MID49
3	9606.ENSP00000368793	0.868	Peptide chain release factor 1, mitochondrial
4	9606.ENSP00000356202	0.842	Peptide chain release factor 1-like, mitochondrial
5	9606.ENSP00000254928	0.783	GTPase Era, mitochondrial
6	9606.ENSP00000461324	0.781	Involved in translocation of malonate, malate and succinate in exchange for phosphate, sulfate, sulfite or thiosulfate across mitochondrial inner membrane
7	9606.ENSP00000355471	0.770	Dimethyladenosine transferase 2, mitochondrial
8	9606.ENSP00000370508	0.761	Translation initiation factor IF-3, mitochondrial
9	9606.ENSP00000297534	0.757	Protein FMC1 homolog
10	9606.ENSP00000341082	0.755	Mitochondrial ribosomal protein L20
11	9606.ENSP00000263629	0.747	Translation initiation factor IF-2, mitochondrial
12	9606.ENSP00000266544	0.741	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
13	9606.ENSP00000384966	0.726	Mitochondrial inner membrane protease subunit 2
14	9606.ENSP00000225969	0.704	Mitochondrial ribosomal protein L27
15	9606.ENSP00000315152	0.698	Methionine aminopeptidase 1D, mitochondrial
16	9606.ENSP00000245539	0.697	Mitochondrial ribosomal protein S7
17	9606.ENSP00000253233	0.689	Probable peptide chain release factor C12orf65, mitochondrial
18	9606.ENSP00000254630	0.688	Pentatricopeptide repeat domain-containing protein 3, mitochondrial
19	9606.ENSP00000317376	0.685	Mitochondrial ribosomal protein S11
20	9606.ENSP00000301585	0.681	Peptidyl-tRNA hydrolase ICT1, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding
GO:0003924	0.998	GTPase activity
GO:0097159	0.992	organic cyclic compound binding
GO:1901363	0.991	heterocyclic compound binding
GO:0003676	0.974	nucleic acid binding
GO:0043021	0.500	ribonucleoprotein complex binding
GO:0003723	0.459	RNA binding
GO:0090079	0.367	translation regulator activity, nucleic acid binding
GO:0008135	0.311	translation factor activity, RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006807	0.997	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0006412	0.994	translation
GO:0071840	0.977	cellular component organization or biogenesis
GO:0016043	0.969	cellular component organization
GO:0140053	0.947	mitochondrial gene expression
GO:0043933	0.942	protein-containing complex organization
GO:0006996	0.935	organelle organization
GO:0022411	0.868	cellular component disassembly
GO:0032543	0.867	mitochondrial translation
GO:0032984	0.812	protein-containing complex disassembly
GO:1903008	0.666	organelle disassembly
GO:0065007	0.359	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.893	mitochondrial matrix
GO:0032991	0.438	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19669	0.998	GTP + H2O = GDP + H(+) + phosphate

[back to server]